1JDB


Conserved Protein Domain Family
CPSaseII_lrg

?
TIGR01369: CPSaseII_lrg 
Click on image for an interactive view with Cn3D
carbamoyl-phosphate synthase, large subunit
Carbamoyl-phosphate synthase (CPSase) catalyzes the first committed step in pyrimidine, arginine, and urea biosynthesis. In general, it is a glutamine-dependent enzyme, EC 6.3.5.5, termed CPSase II in eukaryotes. An exception is the mammalian mitochondrial urea-cycle form, CPSase I, in which the glutamine amidotransferase domain active site Cys on the small subunit has been lost, and the enzyme is ammonia-dependent. In both CPSase I and the closely related, glutamine-dependent CPSase III (allosterically activated by acetyl-glutamate) demonstrated in some other vertebrates, the small and large chain regions are fused in a single polypeptide chain. This model represents the large chain of glutamine-hydrolysing carbamoyl-phosphate synthases, or the corresponding regions of larger, multifunctional proteins, as found in all domains of life, and CPSase I forms are considered exceptions within the family. In several thermophilic species (Methanobacterium thermoautotrophicum, Methanococcus jannaschii, Aquifex aeolicus), the large subunit appears split, at different points, into two separate genes. [Purines, pyrimidines, nucleosides, and nucleotides, Pyrimidine ribonucleotide biosynthesis]
Statistics
?
PSSM-Id: 273581
Aligned: 15 rows
Threshold Bit Score: 1641.26
Threshold Setting Gi: 499203664
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JDB_B          2 PKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVILVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKE 81   Escherichia coli
O28994          2 PKREDIRKIMVIGSGPIVIGQAAEFDYSGSQACKALREEGYEVVLVNSNPATIMTDPEMADRVYIEPLDAEIVAKIIERE 81   Archaeoglobus...
P25994          2 PKRVDINKILVIGSGPIIIGQAAEFDYAGTQACLALKEEGYEVILVNSNPATIMTDTEMADRVYIEPLTPEFLTRIIRKE 81   Bacillus subt...
P27708        388 SGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNE 467  human
P03965         23 QLVEGVNSVLVIGSGGLSIGQAGEFDYSGSQAIKALKEDNKFTILVNPNIATNQTSHSLADKIYYLPVTPEYITYIIELE 102  Saccharomyces...
BAA21087      367 VAKFKPRKVLVLGAGGIVIAQAGEFDYSGSQCLKSLREEGMETVLINPNIATVQTDDEMADHIYFVPLTVEAVERVIEKE 446  Leishmania me...
WP_005875074    2 IDKSKIKKVLLLGSGALKIGEAGEFDYSGSQALKAIREEGIRTVLVNPNIATVQTSEGIADEIYFLPVTPYFVEKVIEKE 81   Porphyromonas...
WP_010901204    2 PRRDDIHRILVIGSGPVVIGQAAEFDYSGSQACLSLREEGYYVVLLNSNPATIQTDHRIADRVYIEPITVEAVERIIEKE 81   Thermoplasma ...
WP_010965932    2 PLDKTIKKVLIIGSGPNNIGQAAEFDYSGTQACKAVKEEGIETVLVNSNPATIMTDSHIADKVYIEPLTEEAVEKIIEKE 81   Clostridium a...
WP_010899042    2 PKRTDIQSVLVIGSGPIVIGQAAEFDYAGAQACLALREEGIQVILVNNNPATVMTDEACADVVYFEPLTVASVKNIIERE 81   Bacillus halo...
O28994          2 PKREDIRKIMVIGSGPIVIGQAAEFDYSGSQACKALREEGYEVVLVNSNPATIMTDPEMADRVYIEPLDAEIVAKIIERE 81   Archaeoglobus...
P25994          2 PKRVDINKILVIGSGPIIIGQAAEFDYAGTQACLALKEEGYEVILVNSNPATIMTDTEMADRVYIEPLTPEFLTRIIRKE 81   Bacillus subt...
P27708        388 SGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAIKALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNE 467  human
P03965         23 QLVEGVNSVLVIGSGGLSIGQAGEFDYSGSQAIKALKEDNKFTILVNPNIATNQTSHSLADKIYYLPVTPEYITYIIELE 102  Saccharomyces...
BAA21087      367 VAKFKPRKVLVLGAGGIVIAQAGEFDYSGSQCLKSLREEGMETVLINPNIATVQTDDEMADHIYFVPLTVEAVERVIEKE 446  Leishmania me...
WP_005875074    2 IDKSKIKKVLLLGSGALKIGEAGEFDYSGSQALKAIREEGIRTVLVNPNIATVQTSEGIADEIYFLPVTPYFVEKVIEKE 81   Porphyromonas...
WP_010901204    2 PRRDDIHRILVIGSGPVVIGQAAEFDYSGSQACLSLREEGYYVVLLNSNPATIQTDHRIADRVYIEPITVEAVERIIEKE 81   Thermoplasma ...
WP_010965932    2 PLDKTIKKVLIIGSGPNNIGQAAEFDYSGTQACKAVKEEGIETVLVNSNPATIMTDSHIADKVYIEPLTEEAVEKIIEKE 81   Clostridium a...
WP_010899042    2 PKRTDIQSVLVIGSGPIVIGQAAEFDYAGAQACLALREEGIQVILVNNNPATVMTDEACADVVYFEPLTVASVKNIIERE 81   Bacillus halo...
1JDB_B         82 RPDAVLPTMGGQTALNCALELERQGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAAD 161  Escherichia coli
O28994         82 TPDALLPTLGGQTALNLAVQLTEMGVLDKYGVELIGAKFEAIKKAEDRELFKEAMRKIGLDVPKSDVAHDVSEALAIADE 161  Archaeoglobus...
P25994         82 RPDAILPTLGGQTGLNLAVELSERGVLAECGVEVLGTKLSAIQQAEDRDLFRTLMNELNEPVPESEIIHSLEEAEKFVSQ 161  Bacillus subt...
P27708        468 RPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAER 547  human
P03965        103 RPDAILLTFGGQTGLNCGVALDESGVLAKYNVKVLGTPIKTLITSEDRDLFASALKDINIPIAESFACETVDEALEAAER 182  Saccharomyces...
BAA21087      447 RPDGILLGWGGQTALNCGVKLDELGVLKKYNVQVLGTPVSVIAVTEDRELFRDTLLQINEQVAKSAAVTSVEEAVVASKD 526  Leishmania me...
WP_005875074   82 RPDGILLAFGGQTALNCGVELYRSGVLEKYGVEVLGTPVQAIMDTEDRELFVRKLDEINVKTIQSQAVESVEEARKAARE 161  Porphyromonas...
WP_010901204   82 KIDAIEPHMGGQTALNLAVKLKNSGILQRYGIKIIGTPVESIELAEDREKFYEFLKAMGEPQPARYRIRRDHIDEDVASI 161  Thermoplasma ...
WP_010965932   82 RPDGILAGFGGQTALNLAMNLNDAGVLDKYNVRLLGINSEAIKKAEDREEFKNLMEEIDEPVPKSIIATHIDECIDFVNK 161  Clostridium a...
WP_010899042   82 RPDGLLATLGGQTGLNLAMKLEEAGILEAYNVELLGTPMESIKKGEDREAFRQLMHELHEPVPESEIVHSVAEAVDFANT 161  Bacillus halo...
O28994         82 TPDALLPTLGGQTALNLAVQLTEMGVLDKYGVELIGAKFEAIKKAEDRELFKEAMRKIGLDVPKSDVAHDVSEALAIADE 161  Archaeoglobus...
P25994         82 RPDAILPTLGGQTGLNLAVELSERGVLAECGVEVLGTKLSAIQQAEDRDLFRTLMNELNEPVPESEIIHSLEEAEKFVSQ 161  Bacillus subt...
P27708        468 RPDGVLLTFGGQTALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQAQAAAER 547  human
P03965        103 RPDAILLTFGGQTGLNCGVALDESGVLAKYNVKVLGTPIKTLITSEDRDLFASALKDINIPIAESFACETVDEALEAAER 182  Saccharomyces...
BAA21087      447 RPDGILLGWGGQTALNCGVKLDELGVLKKYNVQVLGTPVSVIAVTEDRELFRDTLLQINEQVAKSAAVTSVEEAVVASKD 526  Leishmania me...
WP_005875074   82 RPDGILLAFGGQTALNCGVELYRSGVLEKYGVEVLGTPVQAIMDTEDRELFVRKLDEINVKTIQSQAVESVEEARKAARE 161  Porphyromonas...
WP_010901204   82 KIDAIEPHMGGQTALNLAVKLKNSGILQRYGIKIIGTPVESIELAEDREKFYEFLKAMGEPQPARYRIRRDHIDEDVASI 161  Thermoplasma ...
WP_010965932   82 RPDGILAGFGGQTALNLAMNLNDAGVLDKYNVRLLGINSEAIKKAEDREEFKNLMEEIDEPVPKSIIATHIDECIDFVNK 161  Clostridium a...
WP_010899042   82 RPDGLLATLGGQTGLNLAMKLEEAGILEAYNVELLGTPMESIKKGEDREAFRQLMHELHEPVPESEIVHSVAEAVDFANT 161  Bacillus halo...
1JDB_B        162 VGFPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSptKELLIDESLIGWKEYEMEVVRDKNDNCIIVCSIENFDAMG 241  Escherichia coli
O28994        162 IGYPVVVRPAFTLGGTGGGIAYNREELREIAERGIKMSmiNQVLIEEGVLGWKEFELEVMRDLADNVVIICSIENFDPMG 241  Archaeoglobus...
P25994        162 IGFPVIVRPAYTLGGTGGGICSNETELKEIVENGLKLSpvHQCLLEKSIAGYKEIEYEVMRDSQDHAIVVCNMENIDPVG 241  Bacillus subt...
P27708        548 LGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHT--SQVLVDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLG 625  human
P03965        183 VKYPVIVRSAYALGGLGSGFANNASEMKELAAQSLSLA--PQILVEKSLKGWKEVEYEVVRDRVGNCITVCNMENFDPLG 260  Saccharomyces...
BAA21087      527 IGFPMMVRAAYCLGGQGSGIVENMAELRHKVEVALAAS--PQVLLEESVAGWKEIEYEVVRDIYDNCITVCNMENFDPMG 604  Leishmania me...
WP_005875074  162 LGYPVIVRAAYALGGLGSGFCDDEDELNILCEKAFSFSp--QVLVEKSLKGWKEVEYEVVRDRFDNCITVCNMENFDPLG 239  Porphyromonas...
WP_010901204  162 PDIPVIVRTSFSLGGTGGSIVQNRQDLLAMAENLFRASdiDYLEVNESLEGMKEIEYEVIRDSFGNCITVCNMENLDPMG 241  Thermoplasma ...
WP_010965932  162 FGLPVIIRPAFTLGGTGGGIASTMEELKEICDRGIKMSpiGQILLEQSVAGWKELEYEVMRDAKDNCIIVCNMENLDPVG 241  Clostridium a...
WP_010899042  162 VGYPIIVRPAYTLGGAGGGIAESEEALIRIVKGGLELSpiQQCLIEKSIAGFKEIEYEVMRDSNDTCITVCNMENIDPVG 241  Bacillus halo...
O28994        162 IGYPVVVRPAFTLGGTGGGIAYNREELREIAERGIKMSmiNQVLIEEGVLGWKEFELEVMRDLADNVVIICSIENFDPMG 241  Archaeoglobus...
P25994        162 IGFPVIVRPAYTLGGTGGGICSNETELKEIVENGLKLSpvHQCLLEKSIAGYKEIEYEVMRDSQDHAIVVCNMENIDPVG 241  Bacillus subt...
P27708        548 LGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHT--SQVLVDKSLKGWKEIEYEVVRDAYGNCVTVCNMENLDPLG 625  human
P03965        183 VKYPVIVRSAYALGGLGSGFANNASEMKELAAQSLSLA--PQILVEKSLKGWKEVEYEVVRDRVGNCITVCNMENFDPLG 260  Saccharomyces...
BAA21087      527 IGFPMMVRAAYCLGGQGSGIVENMAELRHKVEVALAAS--PQVLLEESVAGWKEIEYEVVRDIYDNCITVCNMENFDPMG 604  Leishmania me...
WP_005875074  162 LGYPVIVRAAYALGGLGSGFCDDEDELNILCEKAFSFSp--QVLVEKSLKGWKEVEYEVVRDRFDNCITVCNMENFDPLG 239  Porphyromonas...
WP_010901204  162 PDIPVIVRTSFSLGGTGGSIVQNRQDLLAMAENLFRASdiDYLEVNESLEGMKEIEYEVIRDSFGNCITVCNMENLDPMG 241  Thermoplasma ...
WP_010965932  162 FGLPVIIRPAFTLGGTGGGIASTMEELKEICDRGIKMSpiGQILLEQSVAGWKELEYEVMRDAKDNCIIVCNMENLDPVG 241  Clostridium a...
WP_010899042  162 VGYPIIVRPAYTLGGAGGGIAESEEALIRIVKGGLELSpiQQCLIEKSIAGFKEIEYEVMRDSNDTCITVCNMENIDPVG 241  Bacillus halo...
1JDB_B        242 IHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVEtGG-SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIA 320  Escherichia coli
O28994        242 VHTGDSITVAPAQTLTDVEYQYLRDAAIKIIREIGVE-TGgSNIQFAVHPENGRVVAIEMNPRVSRSSALASKATGFPIA 320  Archaeoglobus...
P25994        242 IHTGDSIVVAPSQTLSDREYQLLRNVSLKLIRALGIE-GG-CNVQLALDPDSFQYYIIEVNPRVSRSSALASKATGYPIA 319  Bacillus subt...
P27708        626 IHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIV-GE-CNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLA 703  human
P03965        261 VHTGDSMVFAPSQTLSDEEFHMLRSAAIKIIRHLGVI-GE-CNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLA 338  Saccharomyces...
BAA21087      605 VHTGESIVVAPSQTLSNDEFHHLRSASIKIIRHLGIV-GE-CNIQYGLDPFSHRYVVIEVNARLSRSSALASKATGYPLA 682  Leishmania me...
WP_005875074  240 IHTGESIVIAPSQTLTNSEYHKLRELAIRIIRHIGIV-GE-CNVQYALDPDSEDYRVIEVNARLSRSSALASKATGYPLA 317  Porphyromonas...
WP_010901204  242 VHTGESIVVTPSQTLSDIEYQMLRDSAIRIISGLGIE-GA-CNIQFALS--EGRYYVIEVNPRTSRSSALASKATGYPIA 317  Thermoplasma ...
WP_010965932  242 VHTGDSIVTAPSQTLTDKEYHMLRHSALKIIRNLKIE-GG-CNIQFALNPKSNDYIVIEVNPRVSRSSALASKAAGYPIA 319  Clostridium a...
WP_010899042  242 VHTGDSIVVAPSQTLTDQEYQMLRSASLKIIRTLGIV-GG-CNIQFALDPDSKQYYLIEVNPRVSRSSALASKATGYPIA 319  Bacillus halo...
O28994        242 VHTGDSITVAPAQTLTDVEYQYLRDAAIKIIREIGVE-TGgSNIQFAVHPENGRVVAIEMNPRVSRSSALASKATGFPIA 320  Archaeoglobus...
P25994        242 IHTGDSIVVAPSQTLSDREYQLLRNVSLKLIRALGIE-GG-CNVQLALDPDSFQYYIIEVNPRVSRSSALASKATGYPIA 319  Bacillus subt...
P27708        626 IHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLGIV-GE-CNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLA 703  human
P03965        261 VHTGDSMVFAPSQTLSDEEFHMLRSAAIKIIRHLGVI-GE-CNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPLA 338  Saccharomyces...
BAA21087      605 VHTGESIVVAPSQTLSNDEFHHLRSASIKIIRHLGIV-GE-CNIQYGLDPFSHRYVVIEVNARLSRSSALASKATGYPLA 682  Leishmania me...
WP_005875074  240 IHTGESIVIAPSQTLTNSEYHKLRELAIRIIRHIGIV-GE-CNVQYALDPDSEDYRVIEVNARLSRSSALASKATGYPLA 317  Porphyromonas...
WP_010901204  242 VHTGESIVVTPSQTLSDIEYQMLRDSAIRIISGLGIE-GA-CNIQFALS--EGRYYVIEVNPRTSRSSALASKATGYPIA 317  Thermoplasma ...
WP_010965932  242 VHTGDSIVTAPSQTLTDKEYHMLRHSALKIIRNLKIE-GG-CNIQFALNPKSNDYIVIEVNPRVSRSSALASKAAGYPIA 319  Clostridium a...
WP_010899042  242 VHTGDSIVVAPSQTLTDQEYQMLRSASLKIIRTLGIV-GG-CNIQFALDPDSKQYYLIEVNPRVSRSSALASKATGYPIA 319  Bacillus halo...
1JDB_B        321 KVAAKLAVGYTLDELMNDITGgRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKALR 400  Escherichia coli
O28994        321 KIAAKLAVGYTLDEIPNDITK-ETPASFEPTIDYVVVKIPRFAFDKFPTANQVLGSQMKSVGEVMAVGRTFEEALQKAIR 399  Archaeoglobus...
P25994        320 KLAAKIAVGLSLDEMMNPVTG-KTYAAFEPALDYVVSKIPRWPFDKFESANRKLGTQMKATGEVMAIGRTLEESLLKAVR 398  Bacillus subt...
P27708        704 YVAAKLALGIPLPELRNSVTG-GT-AAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALR 781  human
P03965        339 YTAAKIGLGYTLPELPNPITK-TTVANFEPSLDYIVAKIPKWDLSKFQYVDRSIGSSMKSVGEVMAIGRNYEEAFQKALR 417  Saccharomyces...
BAA21087      683 HVATKIALGKGLFEITNGVTK-TTMACFEPSMDYIAVKMPRWDLHKFNMVSQEIGSMMKSVGEVMSIGRTFEEAMQKAIR 761  Leishmania me...
WP_005875074  318 FVAAKLGLGYGLFDLKNSVTQ-TTSAFFEPALDYVVCKIPRWDLGKFHGVSRQLGSSMKSVGEVMAIGRTFEEAIQKGLR 396  Porphyromonas...
WP_010901204  318 RIAAKIAAGYGLHEIKNPITK-STFAAYEPSLDYVTVKIPRWPFDKFS-VDRTIGVQMKSIGEVMGIGRTFEEALMKAIA 395  Thermoplasma ...
WP_010965932  320 KIAAKIAVGYSLDELKNYVTK-NSSACFEPALDYVVVKIPKWPFDKFNTAERHLGTQMKATGEVMAIDRDFESALLKAVT 398  Clostridium a...
WP_010899042  320 RMAAKLSLGYGLHELKNPVTE-DTYASFEPSLDYVVVKFPRWPFDKLVHVNRELGTQMKATGEVMAIERNLEAGLQKAVR 398  Bacillus halo...
O28994        321 KIAAKLAVGYTLDEIPNDITK-ETPASFEPTIDYVVVKIPRFAFDKFPTANQVLGSQMKSVGEVMAVGRTFEEALQKAIR 399  Archaeoglobus...
P25994        320 KLAAKIAVGLSLDEMMNPVTG-KTYAAFEPALDYVVSKIPRWPFDKFESANRKLGTQMKATGEVMAIGRTLEESLLKAVR 398  Bacillus subt...
P27708        704 YVAAKLALGIPLPELRNSVTG-GT-AAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALR 781  human
P03965        339 YTAAKIGLGYTLPELPNPITK-TTVANFEPSLDYIVAKIPKWDLSKFQYVDRSIGSSMKSVGEVMAIGRNYEEAFQKALR 417  Saccharomyces...
BAA21087      683 HVATKIALGKGLFEITNGVTK-TTMACFEPSMDYIAVKMPRWDLHKFNMVSQEIGSMMKSVGEVMSIGRTFEEAMQKAIR 761  Leishmania me...
WP_005875074  318 FVAAKLGLGYGLFDLKNSVTQ-TTSAFFEPALDYVVCKIPRWDLGKFHGVSRQLGSSMKSVGEVMAIGRTFEEAIQKGLR 396  Porphyromonas...
WP_010901204  318 RIAAKIAAGYGLHEIKNPITK-STFAAYEPSLDYVTVKIPRWPFDKFS-VDRTIGVQMKSIGEVMGIGRTFEEALMKAIA 395  Thermoplasma ...
WP_010965932  320 KIAAKIAVGYSLDELKNYVTK-NSSACFEPALDYVVVKIPKWPFDKFNTAERHLGTQMKATGEVMAIDRDFESALLKAVT 398  Clostridium a...
WP_010899042  320 RMAAKLSLGYGLHELKNPVTE-DTYASFEPSLDYVVVKFPRWPFDKLVHVNRELGTQMKATGEVMAIERNLEAGLQKAVR 398  Bacillus halo...
1JDB_B        401 GLEVGATG--FDpkVSLDDPEALTKIRReLKDAGADRIWYIADAFRAG-LSVDGVFNLTNIDRWFLVQIEELVRLEEKVA 477  Escherichia coli
O28994        400 SLEIGRYGlgCD--GKDKEVTMEEIRER-LRYPNASRVFYIRYALQKG-MSVNEIYELTKIDPWFIDKIKNLVEFEEQLK 475  Archaeoglobus...
P25994        399 SLEADVYH--LE--LKDAADISDELLEKrIKKAGDERLFYLAEAYRRG-YTVEDLHEFSAIDVFFLHKLFGIVQFEKEL- 472  Bacillus subt...
P27708        782 MVDENCVG--FD--HT---VKPVSD--MeLETPTDKRIFVVAAALWAG-YSVDRLYELTRIDRWFLHRMKRIIAHAQLLE 851  human
P03965        418 QVDPSLLG--FQ--GS-TEFGDQLD--EaLRTPTDRRVLAIGQALIHEnYTVERVNELSKIDKWFLYKCMNIVNIYKELE 490  Saccharomyces...
BAA21087      762 MVDPSYTG--FS--IPDRFAGADFDYMEhIRHPTPYRLFAICRALLDG-HSAEELYQMTKITRVFLYKLEKLVRLSMATS 836  Leishmania me...
WP_005875074  397 MIGQGMHG--FV--ENKELVIPNID--KaLNEPTDRRIFVISKAFRQG-YTVDKIHELTKIDRWFLEKLYGIVTLAEEME 469  Porphyromonas...
WP_010901204  396 SLDNA-----FS--SNIRLHVPDDELWRlIGKPNDRRIFAIFEGLFRN-FDVKRMSRLSGYDEYFIEKMRNIVEALRNMD 467  Thermoplasma ...
WP_010965932  399 SLEGKISG--LR--LEKFEYTTVRELLEkIKKQDDERIFAIAEAFRRG-VDVKQIHEVTEIDNWYLNGINRIIDMEKELQ 473  Clostridium a...
WP_010899042  399 SLEIKTHG--LS--LPSLSQWEDSELWViVKKADDRRFFAILELLRRG-VTIEAIHEQTKIDRFFLTSFAKLMTLEKEIA 473  Bacillus halo...
O28994        400 SLEIGRYGlgCD--GKDKEVTMEEIRER-LRYPNASRVFYIRYALQKG-MSVNEIYELTKIDPWFIDKIKNLVEFEEQLK 475  Archaeoglobus...
P25994        399 SLEADVYH--LE--LKDAADISDELLEKrIKKAGDERLFYLAEAYRRG-YTVEDLHEFSAIDVFFLHKLFGIVQFEKEL- 472  Bacillus subt...
P27708        782 MVDENCVG--FD--HT---VKPVSD--MeLETPTDKRIFVVAAALWAG-YSVDRLYELTRIDRWFLHRMKRIIAHAQLLE 851  human
P03965        418 QVDPSLLG--FQ--GS-TEFGDQLD--EaLRTPTDRRVLAIGQALIHEnYTVERVNELSKIDKWFLYKCMNIVNIYKELE 490  Saccharomyces...
BAA21087      762 MVDPSYTG--FS--IPDRFAGADFDYMEhIRHPTPYRLFAICRALLDG-HSAEELYQMTKITRVFLYKLEKLVRLSMATS 836  Leishmania me...
WP_005875074  397 MIGQGMHG--FV--ENKELVIPNID--KaLNEPTDRRIFVISKAFRQG-YTVDKIHELTKIDRWFLEKLYGIVTLAEEME 469  Porphyromonas...
WP_010901204  396 SLDNA-----FS--SNIRLHVPDDELWRlIGKPNDRRIFAIFEGLFRN-FDVKRMSRLSGYDEYFIEKMRNIVEALRNMD 467  Thermoplasma ...
WP_010965932  399 SLEGKISG--LR--LEKFEYTTVRELLEkIKKQDDERIFAIAEAFRRG-VDVKQIHEVTEIDNWYLNGINRIIDMEKELQ 473  Clostridium a...
WP_010899042  399 SLEIKTHG--LS--LPSLSQWEDSELWViVKKADDRRFFAILELLRRG-VTIEAIHEQTKIDRFFLTSFAKLMTLEKEIA 473  Bacillus halo...
1JDB_B        478 EV---GIT----GLNADFLRQLKRKGFADARLAKLAGVREAE--------IRKLRDQYDLHPVYKRVDTCAAEFA-TDTA 541  Escherichia coli
O28994        476 QI---AERmsieEVPKEILKKAKELGYSDRQLAVIFNTTERE--------VRRVRKGKGLRVVYKMVDTCAAEFE-AKTP 543  Archaeoglobus...
P25994        473 -----KAN----AGDTDVLRRAKELGFSDQYISREWKMKESE--------LYSLRKQAGIAPVFKMVDTCAAEFE-SETP 534  Bacillus subt...
P27708        852 QH---RGQ----PLPPDLLQQAKCLGFSDKQIALAVLSTELA--------VRKLRQELGICPAVKQIDTVAAEWP-AQTN 915  human
P03965        491 SVk--SLS----DLSKDLLQRAKKLGFSDKQIAVTINKHASTnin--eleIRSLRKTLGIIPFVKRIDTLAAEFP-AQTN 561  Saccharomyces...
BAA21087      837 TLyanRLT----EMPRENLLSMKAHGFSDRQLAQLLNTTAAD--------VRARRVELNVMPLIKQIDTVAGEYPaAQCC 904  Leishmania me...
WP_005875074  470 EFd--KLE----DLSPALLAEAKLRGFSDFQVARAVLKPDATsmesatnqVRAMRKELGILPVVKRIDTLAAEYP-AHTN 542  Porphyromonas...
WP_010901204  468 MG---RI--------PENLLRIKRIGIPDEIISAFCGVPADT--------ITKYRIDRNIMPVYKRIDTCSGEFE-VAVP 527  Thermoplasma ...
WP_010965932  474 -D---KNN----KDKDKSIIKAKKMGFTVAEIARITSLEEGK--------IKNILNVNNVKPVFKMVDTCSGEFE-AETP 536  Clostridium a...
WP_010899042  474 GQ---SLD----DITSDELSTYKKYGFSDEWLASSWGVGLAD--------VRHTRKALGVVPSYKMVDTCAAEFE-AKTP 537  Bacillus halo...
O28994        476 QI---AERmsieEVPKEILKKAKELGYSDRQLAVIFNTTERE--------VRRVRKGKGLRVVYKMVDTCAAEFE-AKTP 543  Archaeoglobus...
P25994        473 -----KAN----AGDTDVLRRAKELGFSDQYISREWKMKESE--------LYSLRKQAGIAPVFKMVDTCAAEFE-SETP 534  Bacillus subt...
P27708        852 QH---RGQ----PLPPDLLQQAKCLGFSDKQIALAVLSTELA--------VRKLRQELGICPAVKQIDTVAAEWP-AQTN 915  human
P03965        491 SVk--SLS----DLSKDLLQRAKKLGFSDKQIAVTINKHASTnin--eleIRSLRKTLGIIPFVKRIDTLAAEFP-AQTN 561  Saccharomyces...
BAA21087      837 TLyanRLT----EMPRENLLSMKAHGFSDRQLAQLLNTTAAD--------VRARRVELNVMPLIKQIDTVAGEYPaAQCC 904  Leishmania me...
WP_005875074  470 EFd--KLE----DLSPALLAEAKLRGFSDFQVARAVLKPDATsmesatnqVRAMRKELGILPVVKRIDTLAAEYP-AHTN 542  Porphyromonas...
WP_010901204  468 MG---RI--------PENLLRIKRIGIPDEIISAFCGVPADT--------ITKYRIDRNIMPVYKRIDTCSGEFE-VAVP 527  Thermoplasma ...
WP_010965932  474 -D---KNN----KDKDKSIIKAKKMGFTVAEIARITSLEEGK--------IKNILNVNNVKPVFKMVDTCSGEFE-AETP 536  Clostridium a...
WP_010899042  474 GQ---SLD----DITSDELSTYKKYGFSDEWLASSWGVGLAD--------VRHTRKALGVVPSYKMVDTCAAEFE-AKTP 537  Bacillus halo...
1JDB_B        542 YMYSTYEEEcEANPS-TDRe--KIMVLGGGPNRIGQGIEFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYF 618  Escherichia coli
O28994        544 YYYSTYEDE-NEALR-SERk--KVMILGAGPNRIGQGIEFDYCCVHAVFSLKDEGYETIMVNCNPETVSTDYDTSDRLYF 619  Archaeoglobus...
P25994        535 YFYSTYEEE-NESVV-TDKk--SVMVLGSGPIRIGQGVEFDYATVHSVWAIKQAGYEAIIVNNNPETVSTDFSISDKLYF 610  Bacillus subt...
P27708        916 YLYLTYWGTtHDLTF-RTP---HVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYF 991  human
P03965        562 YLYTTYNATkNDVEF-NEN---GMLVLGSGVYRIGSSVEFDWCAVNTAKTLRDQGKKTIMINYNPETVSTDFDEVDRLYF 637  Saccharomyces...
BAA21087      905 YLYSTYNAQrDDVPF-TER---MYAVLGCGVYRIGNSVEFDYGGVLVARELRRLGNKVILINYNPETVSTDYDECDRLYF 980  Leishmania me...
WP_005875074  543 YLYLTYSGDrHDVAYeNDKr--SVVVLGSGAYRIGSSVEFDWCGVNALATIRKEGYRSVMINYNPETVSTDYDISDRLYF 620  Porphyromonas...
WP_010901204  528 YMYSTYEDE-DETPD-LSG---SIMIIGSGPNRIAQGLEFDYGSVKAILALRDMGYRSIMLNSNPETVSTDFDISDALFF 602  Thermoplasma ...
WP_010965932  537 YYYSSYENE-DENEV-TDDk--KIVVIGSGPIRIGQGIEFDYCCVHGVWAIKEAGYKSIIINNNPETVSTDFDTADKLYF 612  Clostridium a...
WP_010899042  538 YYYSSWTGE-NDLLL-PEKakeRVLIIGSGPIRIGQGIEFDYCSVHGAKSLRARNFEAIIINNNPETVSTDYETADRLYF 615  Bacillus halo...
O28994        544 YYYSTYEDE-NEALR-SERk--KVMILGAGPNRIGQGIEFDYCCVHAVFSLKDEGYETIMVNCNPETVSTDYDTSDRLYF 619  Archaeoglobus...
P25994        535 YFYSTYEEE-NESVV-TDKk--SVMVLGSGPIRIGQGVEFDYATVHSVWAIKQAGYEAIIVNNNPETVSTDFSISDKLYF 610  Bacillus subt...
P27708        916 YLYLTYWGTtHDLTF-RTP---HVLVLGSGVYRIGSSVEFDWCAVGCIQQLRKMGYKTIMVNYNPETVSTDYDMCDRLYF 991  human
P03965        562 YLYTTYNATkNDVEF-NEN---GMLVLGSGVYRIGSSVEFDWCAVNTAKTLRDQGKKTIMINYNPETVSTDFDEVDRLYF 637  Saccharomyces...
BAA21087      905 YLYSTYNAQrDDVPF-TER---MYAVLGCGVYRIGNSVEFDYGGVLVARELRRLGNKVILINYNPETVSTDYDECDRLYF 980  Leishmania me...
WP_005875074  543 YLYLTYSGDrHDVAYeNDKr--SVVVLGSGAYRIGSSVEFDWCGVNALATIRKEGYRSVMINYNPETVSTDYDISDRLYF 620  Porphyromonas...
WP_010901204  528 YMYSTYEDE-DETPD-LSG---SIMIIGSGPNRIAQGLEFDYGSVKAILALRDMGYRSIMLNSNPETVSTDFDISDALFF 602  Thermoplasma ...
WP_010965932  537 YYYSSYENE-DENEV-TDDk--KIVVIGSGPIRIGQGIEFDYCCVHGVWAIKEAGYKSIIINNNPETVSTDFDTADKLYF 612  Clostridium a...
WP_010899042  538 YYYSSWTGE-NDLLL-PEKakeRVLIIGSGPIRIGQGIEFDYCSVHGAKSLRARNFEAIIINNNPETVSTDYETADRLYF 615  Bacillus halo...
1JDB_B        619 EPVTLEDVLEIVRIEKPKGVIVQYGGQTPLKLARALEAAG--VPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVT 696  Escherichia coli
O28994        620 EPITHEDVMNIYENEQPEGVIVQFGGQTPLNIARELEDSG--ARILGTSVDSIDIAEDRERFAELLERLNIPQPENGIAH 697  Archaeoglobus...
P25994        611 EPLTIEDVMHIIDLEQPMGVVVQFGGQTAINLADELSARG--VKILGTSLEDLDRAEDRDKFEQALGELGVPQPLGKTAT 688  Bacillus subt...
P27708        992 DEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQ--CRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELS 1069 human
P03965        638 EELSYERVMDIYELEQSEGCIISVGGQLPQNIALKLYDNG--CNIMGTNPNDIDRAENRHKFSSILDSIDVDQPEWSELT 715  Saccharomyces...
BAA21087      981 DEVSEETVLDILTKERVRGVVISLGGQIVQNMVLSLKKSG--LPILGTDPANIDMAEDRNKFSKMCDNLGVPQPEWISAT 1058 Leishmania me...
WP_005875074  621 DELTFERVMDILELENPHGVIVSTGGQIPNNLAVRLDEQH--VPILGTSAQSIDNAEDRHKFSAMLDKLGIDQPRWQELS 698  Porphyromonas...
WP_010901204  603 EPVTPEYVVNVIRRSGCAGLIVQFSGQTGQNMARRIEEILgkHIVLGTSTESIDRIEDRTVFSRVIEGLGIKQPPFAIAE 682  Thermoplasma ...
WP_010965932  613 ESLYIDNVMNIIEKEKPEGVIVQFGGQTAINLADKLYKNG--VKILGTSFESIDLAEDREKFSELLKELNIPQAKGMAVT 690  Clostridium a...
WP_010899042  616 EPLAVEDVLNVIEVENVDHVIVQLGGQTAIGLTKGLEEAG--VSILGTTQDVIDQLEDRERFYEFMRSVEVPHIPGKTAE 693  Bacillus halo...
O28994        620 EPITHEDVMNIYENEQPEGVIVQFGGQTPLNIARELEDSG--ARILGTSVDSIDIAEDRERFAELLERLNIPQPENGIAH 697  Archaeoglobus...
P25994        611 EPLTIEDVMHIIDLEQPMGVVVQFGGQTAINLADELSARG--VKILGTSLEDLDRAEDRDKFEQALGELGVPQPLGKTAT 688  Bacillus subt...
P27708        992 DEISFEVVMDIYELENPEGVILSMGGQLPNNMAMALHRQQ--CRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELS 1069 human
P03965        638 EELSYERVMDIYELEQSEGCIISVGGQLPQNIALKLYDNG--CNIMGTNPNDIDRAENRHKFSSILDSIDVDQPEWSELT 715  Saccharomyces...
BAA21087      981 DEVSEETVLDILTKERVRGVVISLGGQIVQNMVLSLKKSG--LPILGTDPANIDMAEDRNKFSKMCDNLGVPQPEWISAT 1058 Leishmania me...
WP_005875074  621 DELTFERVMDILELENPHGVIVSTGGQIPNNLAVRLDEQH--VPILGTSAQSIDNAEDRHKFSAMLDKLGIDQPRWQELS 698  Porphyromonas...
WP_010901204  603 EPVTPEYVVNVIRRSGCAGLIVQFSGQTGQNMARRIEEILgkHIVLGTSTESIDRIEDRTVFSRVIEGLGIKQPPFAIAE 682  Thermoplasma ...
WP_010965932  613 ESLYIDNVMNIIEKEKPEGVIVQFGGQTAINLADKLYKNG--VKILGTSFESIDLAEDREKFSELLKELNIPQAKGMAVT 690  Clostridium a...
WP_010899042  616 EPLAVEDVLNVIEVENVDHVIVQLGGQTAIGLTKGLEEAG--VSILGTTQDVIDQLEDRERFYEFMRSVEVPHIPGKTAE 693  Bacillus halo...
1JDB_B        697 AIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLDHFLDDAVEVDVDAICDGEMVLIG 776  Escherichia coli
O28994        698 SLEEAKEIARKIGFPVLVRPSYVLGGRAMEIVYDEETLERYITEALEVSPEKPILIDKFLEDAIEVEVDALCDGEEVVIG 777  Archaeoglobus...
P25994        689 SVNQAVSIASDIGYPVLVRPSYVLGGRAMEIVYHEEELLHYMKNAVKINPQHPVLIDRYLT-GKEIEVDAVSDGETVVIP 767  Bacillus subt...
P27708       1070 DLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVASDGVVAAI 1149 human
P03965        716 SVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDVSPDHPVVMSKFIEGAQEIDVDAVAYNGNVLVH 795  Saccharomyces...
BAA21087     1059 SVEQVHEFCDRVGYPALVRPSYVLSGSAMAVIANKEDVTRYLKEASFVSGEHPVVVSKYYEDATEYDVDIVAHHGRVLCY 1138 Leishmania me...
WP_005875074  699 SMDDIDGFVAEVGYPVLVRPSYVLSGAAMNVCSNDEELHRFLELAANVSKQHPVVVSQFIEHAKEVEMDAVARDGEIIAY 778  Porphyromonas...
WP_010901204  683 NENDTVRKAMGLGLPIILRSSHVIGGRSMEIIYDVDYLADRAREIFAISKN--VLVSKYLENAVEMDVDFVSDGTSYSIC 760  Thermoplasma ...
WP_010965932  691 SMEEAYEAVKEIGYPVIVRPSYVIGGRAMQVVYDKLALQKYMTEAVTLSTEHPVLIDKYIK-GTEIEVDTISDGENILIP 769  Clostridium a...
WP_010899042  694 TKEELLKAAQSIGYPILLRPSYVIGGQGMFIASNQEELAAFCEDKN-HSVTFPILVDAYYP-GVEFEVDVLTDGSDIFIP 771  Bacillus halo...
O28994        698 SLEEAKEIARKIGFPVLVRPSYVLGGRAMEIVYDEETLERYITEALEVSPEKPILIDKFLEDAIEVEVDALCDGEEVVIG 777  Archaeoglobus...
P25994        689 SVNQAVSIASDIGYPVLVRPSYVLGGRAMEIVYHEEELLHYMKNAVKINPQHPVLIDRYLT-GKEIEVDAVSDGETVVIP 767  Bacillus subt...
P27708       1070 DLESARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVASDGVVAAI 1149 human
P03965        716 SVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDVSPDHPVVMSKFIEGAQEIDVDAVAYNGNVLVH 795  Saccharomyces...
BAA21087     1059 SVEQVHEFCDRVGYPALVRPSYVLSGSAMAVIANKEDVTRYLKEASFVSGEHPVVVSKYYEDATEYDVDIVAHHGRVLCY 1138 Leishmania me...
WP_005875074  699 SMDDIDGFVAEVGYPVLVRPSYVLSGAAMNVCSNDEELHRFLELAANVSKQHPVVVSQFIEHAKEVEMDAVARDGEIIAY 778  Porphyromonas...
WP_010901204  683 NENDTVRKAMGLGLPIILRSSHVIGGRSMEIIYDVDYLADRAREIFAISKN--VLVSKYLENAVEMDVDFVSDGTSYSIC 760  Thermoplasma ...
WP_010965932  691 SMEEAYEAVKEIGYPVIVRPSYVIGGRAMQVVYDKLALQKYMTEAVTLSTEHPVLIDKYIK-GTEIEVDTISDGENILIP 769  Clostridium a...
WP_010899042  694 TKEELLKAAQSIGYPILLRPSYVIGGQGMFIASNQEELAAFCEDKN-HSVTFPILVDAYYP-GVEFEVDVLTDGSDIFIP 771  Bacillus halo...
1JDB_B        777 GIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQVQKLAFELQVRGLMNVQFAVKN-NEVYLIEVNPRAARTVPFVSK 855  Escherichia coli
O28994        778 GIMEHIEEAGVHSGDSACVLPPVSLDEVTINTIVDYTRKLALALNVVGLINIQYAVKD-GKVYVLEANPRASRTVPFVSK 856  Archaeoglobus...
P25994        768 GIMEHIERAGVHSGDSIAVYPPQSLTEDIKKKIEQYTIALAKGLNIVGLLNIQFVLSQ-GEVYVLEVNPRSSRTVPFLSK 846  Bacillus subt...
P27708       1150 AISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQLIAKD-DQLKVIECNVRVSRSFPFVSK 1228 human
P03965        796 AISEHVENAGVHSGDASLVLPPQHLSDDVKIALKDIADKVAKAWKITGPFNMQIIKDGeHTLKVIECNIRASRSFPFVSK 875  Saccharomyces...
BAA21087     1139 GICEHVENAGVHSGDATMFLPPQNTDKDTMKRIYDSVNRIAEKLDVVGPMNVQFLLTAeGHLRVIEANVRKFRSVPFVSK 1218 Leishmania me...
WP_005875074  779 AISEHIEFAGVHSGDATIQFPAQKLYVETVRRIKRISREIAKALKISGPFNIQFLAKG-NDIKVIECNLRASRSFPFVSK 857  Porphyromonas...
WP_010901204  761 GIIVHIEEAGVHSGDATMVYGPGIVPVDIEKKIEGIVGSMVREFRLIGLSNLQIAVRD-GDVYVIELNARSSRSVPFISK 839  Thermoplasma ...
WP_010965932  770 GIMEHIERTGVHSGDSITMYPYHTLPKEVVDKLVKYTKSLAKALEVKGLMNIQYVYDG-ENVYVIEVNPRASRTVPILSK 848  Clostridium a...
WP_010899042  772 GMFEHVEKAGVHSGDSMAVTPPPTLEAKWKQQAINYTRQIAKGMAYKGLFNIQFVLYD-EELYVIEVNPRASRTVPIFSK 850  Bacillus halo...
O28994        778 GIMEHIEEAGVHSGDSACVLPPVSLDEVTINTIVDYTRKLALALNVVGLINIQYAVKD-GKVYVLEANPRASRTVPFVSK 856  Archaeoglobus...
P25994        768 GIMEHIERAGVHSGDSIAVYPPQSLTEDIKKKIEQYTIALAKGLNIVGLLNIQFVLSQ-GEVYVLEVNPRSSRTVPFLSK 846  Bacillus subt...
P27708       1150 AISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQLIAKD-DQLKVIECNVRVSRSFPFVSK 1228 human
P03965        796 AISEHVENAGVHSGDASLVLPPQHLSDDVKIALKDIADKVAKAWKITGPFNMQIIKDGeHTLKVIECNIRASRSFPFVSK 875  Saccharomyces...
BAA21087     1139 GICEHVENAGVHSGDATMFLPPQNTDKDTMKRIYDSVNRIAEKLDVVGPMNVQFLLTAeGHLRVIEANVRKFRSVPFVSK 1218 Leishmania me...
WP_005875074  779 AISEHIEFAGVHSGDATIQFPAQKLYVETVRRIKRISREIAKALKISGPFNIQFLAKG-NDIKVIECNLRASRSFPFVSK 857  Porphyromonas...
WP_010901204  761 GIIVHIEEAGVHSGDATMVYGPGIVPVDIEKKIEGIVGSMVREFRLIGLSNLQIAVRD-GDVYVIELNARSSRSVPFISK 839  Thermoplasma ...
WP_010965932  770 GIMEHIERTGVHSGDSITMYPYHTLPKEVVDKLVKYTKSLAKALEVKGLMNIQYVYDG-ENVYVIEVNPRASRTVPILSK 848  Clostridium a...
WP_010899042  772 GMFEHVEKAGVHSGDSMAVTPPPTLEAKWKQQAINYTRQIAKGMAYKGLFNIQFVLYD-EELYVIEVNPRASRTVPIFSK 850  Bacillus halo...
1JDB_B        856 ATGVPLAKVAARVMAGKSLAEqg--vTKEVIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAKAQL 933  Escherichia coli
O28994        857 ATGIPLAKIAAKLMMGKKLRElg--vKEKLKLKHVAVKEAVFPFIKLPGVDPVLGPEMKSTGEVMGIDYDFGLAYYKAEL 934  Archaeoglobus...
P25994        847 ITGIPMANLATKIILGQKLAAfgyteGLQPEQQGVFVKAPVFSFAKLRRVDITLGPEMKSTGEVMGKDSTLEKALYKALI 926  Bacillus subt...
P27708       1229 TLGVDLVALATRVIMGEEVEPv----gLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAML 1304 human
P03965        876 VLGVNFIEIAVKAFLGGDIVPkpvdlMLNKKYDYVATKVPQFSFTRLAGADPFLGVEMASTGEVASFGRDLIESYWTAIQ 955  Saccharomyces...
BAA21087     1219 TLGISFPSVMVSAFLARKDQNlv--pIKRAKMTHIGCKASMFSFIPLAGADPILGVEMASTGEIGVFGRDKHEVFLKAML 1296 Leishmania me...
WP_005875074  858 VLKINFIELATRIMLGLPVEKpn---kSEFDLDYVGIKASQFSFTRLQKADPVLGVDMTSTGEVGCIADDTDEAVLKSML 934  Porphyromonas...
WP_010901204  840 ATGIDWVRLAVECMIGSRIEN------KRMEAKSYFLKVSVFPFSKFSDMDVVYGPEMKSTGEAMYPGRTLAEALRKSLQ 913  Thermoplasma ...
WP_010965932  849 VTGVPMVKLAVEILTGKNLKElgygvDLKKDNKLYAVKVPVFSNEKLANVDIYLGPEMRSTGEVMGIDSDFEVAIYKGFR 928  Clostridium a...
WP_010899042  851 ATSLPLITYTIDVLFGKTIAElglsaGYRKESPYYTVKAPVFSYQKLAGLDPLLEAEMKSTGELIAISKDLPSAFRKAFA 930  Bacillus halo...
O28994        857 ATGIPLAKIAAKLMMGKKLRElg--vKEKLKLKHVAVKEAVFPFIKLPGVDPVLGPEMKSTGEVMGIDYDFGLAYYKAEL 934  Archaeoglobus...
P25994        847 ITGIPMANLATKIILGQKLAAfgyteGLQPEQQGVFVKAPVFSFAKLRRVDITLGPEMKSTGEVMGKDSTLEKALYKALI 926  Bacillus subt...
P27708       1229 TLGVDLVALATRVIMGEEVEPv----gLMTGSGVVGVKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAML 1304 human
P03965        876 VLGVNFIEIAVKAFLGGDIVPkpvdlMLNKKYDYVATKVPQFSFTRLAGADPFLGVEMASTGEVASFGRDLIESYWTAIQ 955  Saccharomyces...
BAA21087     1219 TLGISFPSVMVSAFLARKDQNlv--pIKRAKMTHIGCKASMFSFIPLAGADPILGVEMASTGEIGVFGRDKHEVFLKAML 1296 Leishmania me...
WP_005875074  858 VLKINFIELATRIMLGLPVEKpn---kSEFDLDYVGIKASQFSFTRLQKADPVLGVDMTSTGEVGCIADDTDEAVLKSML 934  Porphyromonas...
WP_010901204  840 ATGIDWVRLAVECMIGSRIEN------KRMEAKSYFLKVSVFPFSKFSDMDVVYGPEMKSTGEAMYPGRTLAEALRKSLQ 913  Thermoplasma ...
WP_010965932  849 VTGVPMVKLAVEILTGKNLKElgygvDLKKDNKLYAVKVPVFSNEKLANVDIYLGPEMRSTGEVMGIDSDFEVAIYKGFR 928  Clostridium a...
WP_010899042  851 ATSLPLITYTIDVLFGKTIAElglsaGYRKESPYYTVKAPVFSYQKLAGLDPLLEAEMKSTGELIAISKDLPSAFRKAFA 930  Bacillus halo...
1JDB_B        934 GSN----STMKKHGRALLSVREGDK-ERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPRLVNKVHEGR--------PH 1000 Escherichia coli
O28994        935 AAG----MKLPLKGTVFISVRRKDKnDRLLYLARKFKELGFRIIATDGTRDFLVQNGIEADLILKISQGR--------PN 1002 Archaeoglobus...
P25994        927 ASGi---QIPNYG-SVLLTVADKDK-EEGLAIAKRFHAIGYNILATEGTAGYLKEASIPAKVVGKIGQDG--------PN 993  Bacillus subt...
P27708       1305 STG----FKIPKKNILLTIGSYKNK-SELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAvdgecppqRS 1379 human
P03965        956 STMn---FHVPLPPSGILFGGDTSR-EYLGQVASIVATIGYRIYTTNETTKTYLQEHIKEKNAKVSLIKFpkn---dkRK 1028 Saccharomyces...
BAA21087     1297 CQN----FRIPKKGVFFSIDVDSQT-EALCPYIQHLVGRGLKVYGTANTAAVLHEYGIECEVLLQRSELPsgdacesnRP 1371 Leishmania me...
WP_005875074  935 SVG----YRIPQKSVLLSTGGYKQK-VDMLDATTMLAAKGYKIYATEGTHNFLRENGIESTKVFWPSENGq-------PQ 1002 Porphyromonas...
WP_010901204  914 RSI----------SSVLITVRDEDK-PRIVDIARILLEKGVKLYATAGTSKFLADHGIPTETLYRVRDRRe-------PR 975  Thermoplasma ...
WP_010965932  929 AAGi---EVPKDGGNLYVSIKDVDK-QESVPIIKKYTEFGYKIYASLGTGKFLQKQGIDCEVLR-----T--------DD 991  Clostridium a...
WP_010899042  931 WGEeqtpALFRKKGSVFCQVDRAYD-TEWQPLLRQLKEKGYSVVTEEAM------------------------------S 979  Bacillus halo...
O28994        935 AAG----MKLPLKGTVFISVRRKDKnDRLLYLARKFKELGFRIIATDGTRDFLVQNGIEADLILKISQGR--------PN 1002 Archaeoglobus...
P25994        927 ASGi---QIPNYG-SVLLTVADKDK-EEGLAIAKRFHAIGYNILATEGTAGYLKEASIPAKVVGKIGQDG--------PN 993  Bacillus subt...
P27708       1305 STG----FKIPKKNILLTIGSYKNK-SELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAvdgecppqRS 1379 human
P03965        956 STMn---FHVPLPPSGILFGGDTSR-EYLGQVASIVATIGYRIYTTNETTKTYLQEHIKEKNAKVSLIKFpkn---dkRK 1028 Saccharomyces...
BAA21087     1297 CQN----FRIPKKGVFFSIDVDSQT-EALCPYIQHLVGRGLKVYGTANTAAVLHEYGIECEVLLQRSELPsgdacesnRP 1371 Leishmania me...
WP_005875074  935 SVG----YRIPQKSVLLSTGGYKQK-VDMLDATTMLAAKGYKIYATEGTHNFLRENGIESTKVFWPSENGq-------PQ 1002 Porphyromonas...
WP_010901204  914 RSI----------SSVLITVRDEDK-PRIVDIARILLEKGVKLYATAGTSKFLADHGIPTETLYRVRDRRe-------PR 975  Thermoplasma ...
WP_010965932  929 AAGi---EVPKDGGNLYVSIKDVDK-QESVPIIKKYTEFGYKIYASLGTGKFLQKQGIDCEVLR-----T--------DD 991  Clostridium a...
WP_010899042  931 WGEeqtpALFRKKGSVFCQVDRAYD-TEWQPLLRQLKEKGYSVVTEEAM------------------------------S 979  Bacillus halo...
1JDB_B       1001 IQ---DRIKNGEYTYIINTTS--GRR---------AIEDSRVIRRSALQYKVHYDTTLNGG