2FYF


Conserved Protein Domain Family
serC_3

?
TIGR01366: serC_3 
Click on image for an interactive view with Cn3D
phosphoserine aminotransferase, putative
This model represents a putative variant form of the serine biosynthesis enzyme phosphoserine aminotransferase, as found in Mycobacterium tuberculosis and related high-GC Gram-positive bacteria. [Amino acid biosynthesis, Serine family]
Statistics
?
PSSM-Id: 130433
View PSSM: TIGR01366
Aligned: 4 rows
Threshold Bit Score: 705.925
Threshold Setting Gi: 12541582
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FYF_A    38 KPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGRVRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGL 117 Mycobacterium tuber...
Q10534    16 KPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGRVRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGL 95  Mycobacterium tuber...
CAC25176  12 IPGDGRFGCGPSKVRPEQIQAIVDGSASVIGTSHRQPAVKNVVGSIREGLSDLFSLPEGYEIILSLGGATAFWDAATFGL 91  Corynebacterium glu...
CAC08322   2 KPADGRFGAGPSKVRVEALDALAATGTSLLGTSHRQAPVKNLVGKVREGIRELFRLPDGYEVILGNGGSTAFWDVATHGL 81  Streptomyces coelic...
2FYF_A   118 IDKRSLHLTYGEFSAKFASAVSKNPFVGEPIIITSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSDD-ALVV 196 Mycobacterium tuber...
Q10534    96 IDKRSLHLTYGEFSAKFASAVSKNPFVGEPIIITSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSDD-ALVV 174 Mycobacterium tuber...
CAC25176  92 IEKKSGHLSFGEFSSKFAKASKLAPWLDEPEIVTAETGDSPAPQAFEGADVIAWAHNETSTGAMVPVLRPEGSEG-SLVA 170 Corynebacterium glu...
CAC08322  82 IENKSQHLSFGEFSSKFAKAAKLAPWLAEPTVVAADPGTHPEARAEAGVDVYGLTHNETSTGVAMPIRRVAGADEgALVL 161 Streptomyces coelic...
2FYF_A   197 IDATSGAGGLPVDIAETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAVENSLKNQTYNTPA 276 Mycobacterium tuber...
Q10534   175 IDATSGAGGLPVDIAETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAVENSLKNQTYNTPA 254 Mycobacterium tuber...
CAC25176 171 IDATSGAGGLPVDIKNSDVYYFSPQKCFASDGGLWLAAMSPAALERIEKINASDRFIPEFLNLQTAVDNSLKNQTYNTPA 250 Corynebacterium glu...
CAC08322 162 VDATSGAGGLPVDISETDVYYFAPQKSFASDGGLWIGVFSPAAIERAERVHASGRHVPEFFSLPTAIDNSRKNQTYNTPA 241 Streptomyces coelic...
2FYF_A   277 IATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTPFVTDPGLRSQVVGTIDFVDDVDAGTVAKILRANG 356 Mycobacterium tuber...
Q10534   255 IATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTPFVTDPGLRSQVVGTIDFVDDVDAGTVAKILRANG 334 Mycobacterium tuber...
CAC25176 251 VATLLMLDNQVKWMNSNGGLDGMVARTTASSSALYNWAEAREEASPYVADAAKRSLVVGTIDFDDSIDAAVIAKILRANG 330 Corynebacterium glu...
CAC08322 242 LATLFLLGEQLDWMNGQGGLDFTTARTKDSSSRLYTWADESKYATPFVSDPTKRSQVIGTIDFSDDIDAAAVAKVLRANG 321 Streptomyces coelic...
2FYF_A   357 IVDTEPYRKLGRNQLRVAMFPAVEPDDVSALTECVDWVVERL 398 Mycobacterium tuberculosis H37Rv
Q10534   335 IVDTEPYRKLGRNQLRVAMFPAVEPDDVSALTECVDWVVERL 376 Mycobacterium tuberculosis
CAC25176 331 ILDTEPYRKLGRNQLRIGMFPAIDSTDVEKLTGAIDFILDGG 372 Corynebacterium glutamicum
CAC08322 322 IVDTEPYRKLGRNQLRVAMFPAIDPADVEALTKCVDHVIEKL 363 Streptomyces coelicolor A3(2)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap