Conserved Protein Domain Family
serC_2

?
TIGR01365: serC_2 
phosphoserine aminotransferase, Methanosarcina type
This model represents a variant form of the serine biosynthesis enzyme phosphoserine aminotransferase, as found in a small number of distantly related species, including Caulobacter crescentus, Mesorhizobium loti, and the archaeon Methanosarcina barkeri. [Amino acid biosynthesis, Serine family]
Statistics
?
PSSM-Id: 130432
View PSSM: TIGR01365
Aligned: 3 rows
Threshold Bit Score: 725.205
Threshold Setting Gi: 499223509
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P52878         6 VPNNPCFSSGPCAKHPGYSIEELKDTPFGRSHRSNLGKEKLAEAIKKTRDMLGLPDDYLVGIVPASDTGAFEMCLWSMLG 85  Methanosarcina ...
WP_010912016  10 RPANPNFSSGPCAKRPGWSVEALKNAALGRSHRAKIGKTKLEQAIELTREILQVPADHRIGIVPASDTGAVEMALWSLLG 89  Mesorhizobium loti
WP_010921049  11 RPARPEFSSGPCAKRPGWTPENLRNAVLGRSHRSKLGKARLKAAIDQTREVLEVPADFLIGIVAGSDTGAVEMAMWSMLG 90  Caulobacter vib...
P52878        86 CRGVDVLVWESFSKGWATDITKQLKLKDVRVFEAEYGKLPDLKKVDFKNDVVFVWNGTTSGVKVPNGDWIPENREGLTLC 165 Methanosarcina ...
WP_010912016  90 ERGVDMVAWESFGSGWVTDVVKQLKLPDVRKLEAGYGELPDLAKIDFDRDVVFTWNGTTSGVRVPNGDFIPADRKGLTIC 169 Mesorhizobium loti
WP_010921049  91 ARPVQLLAFESFGKDWVTDVTKQLKLPDVEVLSAPYGQLPDTSKVDPAKDLVFTWNGTTSGVRVPNADFISADREGITIC 170 Caulobacter vib...
P52878       166 DATSAIFAMDIPYHKLDVITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTK-----GGKLNKKIFEGS 240 Methanosarcina ...
WP_010912016 170 DATSAAFAQRLDFEKLDVVTFSWQKVLGGEGAHGMLILSPRAVARLESYKPAWPLPKIFRLTS-----GGKLIEGIFKGE 244 Mesorhizobium loti
WP_010921049 171 DATSAAFAQDLDWTKLDVVTFSWQKALGGEGAHGVLILSPRAVARLESYTPAWPMPKLFRMTKankdgGNKVSLDIFEGA 250 Caulobacter vib...
P52878       241 TINTPSMLANEDWLATLKWAESVGGLKPLIQRTNDNLAVFEAFVAKNNWIHFLAETKEIRSSTSVCFKV-----DLSDEK 315 Methanosarcina ...
WP_010912016 245 TINTPSMLCVEDYLDALHWAKSIGGLDVLVARADANAAVLDGFVDKSSWLGHLAVQPATRSNTSVCLSFtdpdvAALDAD 324 Mesorhizobium loti
WP_010921049 251 TINTPSMLCVEDALDALKWASSIGGLQAMQARADQNLKVLADWVAKTPWVDFLAATPEIRSNTSVCLKVvdpaiCALPED 330 Caulobacter vib...
P52878       316 -----LKELIKTLEKEKVAYDIGSYRDAPSGLRIWCGATVEKEDLQCLCEWIEWAYNLV 369 Methanosarcina barkeri str. Fusaro
WP_010912016 325 gqatfAKGLVSALDKEGVAYDIGSYRDAPPGLRIWCGATVETSDLETLLPWLDWAFAAQ 383 Mesorhizobium loti
WP_010921049 331 aqadfAKKLASLLEKEGAALDIGGYRDAPAGLRIWCGATVEASDLEALTPWLDWAFATV 389 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap