3E77


Conserved Protein Domain Family
serC_1

?
TIGR01364: serC_1 
Click on image for an interactive view with Cn3D
phosphoserine aminotransferase
This model represents the common form of the phosphoserine aminotransferase SerC. The phosphoserine aminotransferase of the archaeon Methanosarcina barkeri and putative phosphoserine aminotransferase of Mycobacterium tuberculosis are represented by separate models. All are members of the class V aminotransferases (pfam00266). [Amino acid biosynthesis, Serine family]
Statistics
?
PSSM-Id: 130431
View PSSM: TIGR01364
Aligned: 15 rows
Threshold Bit Score: 529.543
Threshold Setting Gi: 464758
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3E77_A        22 SMLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLigLK 101 human
P10658        15 AKLPHSVLLEIQKELLDYKGLGISVLEMSHRSSDFAKIVNNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNL--IG 92  rabbit
P91856        15 AKLPEEVLLKMQEEQLNFNNLGVSVIEMSHRSKEFGALLNETISLIRELMNVPDNFEILFMQGGGTGQFAAIPLNL--KG 92  Caenorhabditis ...
Q10349        15 AAMITSVVEEFGKDFVNFQGLGMGVAEISHRSKQGSGIVTSAESNFRKLYNIPENFHILFMQGGGTEQFAACLYNV--YA 92  Schizosaccharom...
P81435        12 AMIPKDVLYQAKKELQNWNQIGCSIMEISHRSKEFIQVALEAEQDLRDLLNISNSYEILFCQGGARGQFAAVPMNL--LG 89  Buchnera aphidi...
Q96255        81 ATLPENVLLKAQADLYNWRGSGMSVMEMSHRGKEFLSIIQKAESDLRQLLEIPQEYSVLFLQGGATTQFAALPLNL--CK 158 thale cress
WP_010897357  12 SALPTEVLEKAQSELLDFENTGMSVMELSHRSKEYENVHHTAAQLLRDLLNIPEDYDVLFLQGGASLQFAMIPLNF--LD 89  Bacillus halodu...
WP_005722605  12 AMMPEAVLAQAQAELLNWQEQQTSVMEVSHRGKLFMALASQSELDLRQLYQIPDNYRILFLQGGARGQFAAIPMNL--LK 89  Pasteurella mul...
WP_002858670  11 STLPLEILEQAQKELCDYQGRGYSIMEISHRTKVFEEVHFGAQEKAKKLYELNDDYEVLFLQGGASLQFAMIPMNL--AL 88  Campylobacter j...
WP_003129506  10 SVLPKEVLKKVQEELLDFEKSGMSVMEISHRSKAFQKVIDEAENDLRDLMSIPQNYKILFLQGGASSQFSMVPMNL--AI 87  Lactococcus lactis
3E77_A       102 --AGR-------CADYVVTGAWSAKAAEEAKKFGT-----INIV-HPk-LGSYTKIPDPSTWNLN---P-DASYVYYCAN 161 human
P10658        93 lkPGR-------CADYVVTGAWSAKAAEEAKKFGT-----VNIVhPK--LGSYTKIPDPSTWNLN---P-DASYVYYCAN 154 rabbit
P91856        93 --DHE-------HADYIVTGAWSSKAADEAGKYIN-----VKKVfQP--SKPYVTVPDQENWVHD---E-KAAYLYYCAN 152 Caenorhabditis ...
Q10349        93 hhALKngnakslVANYIITGAWSKKAYAEAERLGFpc--hVAVDmKEl-aGKYGSLPEDKDLKFTpdgE-T-SLVYYCDN 167 Schizosaccharom...
P81435        90 --NFK-------ETDYINSGYWSNCALIEAKKYCI-----PKNIsVRqkKNGKSFLLKPSQWNIS---D-NSAYIHYCPN 151 Buchnera aphidi...
Q96255       159 --SDD-------TVDFVVTGSWGDKAVKEAKKYCK-----TNVIwSGk-SEKYTKVPSFEELEQT---P-DAKYLHICAN 219 thale cress
WP_010897357  90 --EGK-------VANYILTGSWSEKALKEAKFIGk-----TAIAgSTk-ESNYTFIPDISSLQYN---E-HDSYVHLTSN 150 Bacillus halodu...
WP_005722605  90 --EKG-------KALYLTSGHWSATAAKEARLFGD-----IDEVnILe-EGNELKIGQLDFSHIA---D-QYDYVHYCPN 150 Pasteurella mul...
WP_002858670  89 --NG--------VCEYANTGVWTKKAIKEAQILGVn----VKTVaSSe-ESNFDHIP---RVEFS---D-NADYAYICSN 146 Campylobacter j...
WP_003129506  88 ---GK-------KAYYNISGAFGEKAYDEAVKLSHfldlmAISLgSTk-KDNYNHLLKIDKSKID---EkNGAYLHLTTN 153 Lactococcus lactis
3E77_A       162 ETVHGVEFD--FIPDVKG--AVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALR-------- 229 human
P10658       155 ETVHGVEFD--FVPDVKG--AILVCDMSSNFLSRPVDVSKFGVIFAGAQKNVGAAGVTVVIVRDDLLGFALR-------- 222 rabbit
P91856       153 ETVHGIEFTp-TAPESHN--VPLVADVSSNFMARPFDFKDHGVVFGGAQKNLGAAGLTIVIVRKDLIGKQQA-------- 221 Caenorhabditis ...
Q10349       168 ETVHGVEFN--EPPTNIPkgAIRVCDVSSNFISRKIDFTKHDIIFAGAQKNAGPAGITVVFVRDSVLARPTPaelhklni 245 Schizosaccharom...
P81435       152 ETIDGMSIY--EEPNFKN--KIIVGDFSSFILSRRINIENYGLIYAGAQKNIGPSGITIILIRKDLIGYASK-------- 219 Buchnera aphidi...
Q96255       220 ETIHGVEFK--DYPVPKN--GFLVADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNAQD-------- 287 thale cress
WP_010897357 151 NTIFGTQWH--TYPSVSH--APLIVDMSSDILSRPLPVKNFDLIYAGAQKNLGPSGVTVVIIRKELLKRNVD-------- 218 Bacillus halodu...
WP_005722605 151 ETISGVEIF--DLPKVGN--AVLVADMSSNILSRKIDISQFGLIYAGAQKNLGPAGITLVIVREDLIGHARQ-------- 218 Pasteurella mul...
WP_002858670 147 NTIYGTQYQ--NYPK-TK--TPLIVDASSDFFSRKVDFSNIALFYGGVQKNAGISGLSCIFIRKDMLERSKNk------- 214 Campylobacter j...
WP_003129506 154 NTIEGTSIFpeNLPEFAS--LPLVADMSSNILAVDYDVSKFGLIYAGAQKNLGIAGLTIVIIREDLLNEAES-------- 223 Lactococcus lactis
3E77_A       230 -ECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKM 308 human
P10658       223 -ECPSVLEYKVQATSSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMKKLSTIKSQMIYEIIDNSQGFYVCPVEPRNRSMM 301 rabbit
P91856       222 -ITPSVFSYKEMIANNSLYNTPPTGGIYTTNLVLKWIKSKGGLQAIYELNLQKSGMIYDIIDNSNGFYHCAVDKRYRSIM 300 Caenorhabditis ...
Q10349       246 pVSPTVSDYKIMADNHSLYNTLPVATLHAINLGLEYMLEHGGLVALEASSIEKSKLLYDTLDKH-DLYISVVEPAARSRM 324 Schizosaccharom...
P81435       220 -ISPSIFNYYIISKYNSMFNTPPTFSWYLSGLVFKWLKKQGGIKKIEQLNQKKSNLLYQIIDNSN-FYINDIDKRNRSQM 297 Buchnera aphidi...
Q96255       288 -ITPVMLDYKIHDENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQRKADLLYNAIEESNGFFRCPVEKSVRSLM 366 thale cress
WP_010897357 219 -HVPTMLRYQTHAEKQSLYNTPPTFGIYMLKEVLQWLKNIGGTEQIAERNQTKANLIYGAIDESEQFYKGHATKESRSLM 297 Bacillus halodu...
WP_005722605 219 -TTPTIWNYEIQSKADSMINTPPTFAWYLCALVFKHLLSLGGIEEIEKRNQAKAQLLYDYLESTP-FYRNPVAKVNRSRM 296 Pasteurella mul...
WP_002858670 215 -QIPSMLNYLTHAENQSLFNTPPTFAIYMFNLEMDWLLNQGGLDKVHEKNSQKATMLYECIDLSNGFYKGHADKKDRSLM 293 Campylobacter j...
WP_003129506 224 --LSSMMDYQILVENGSMYNTPPTFAIYVAGLVFKWVKAQGGVKKLEEMNQRKAQLLYDLIDQSDFYQNPIKNKDERSIC 301 Lactococcus lactis
3E77_A       309 NIPFRIGNakgdD----ALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMH 375 human
P10658       302 NIPFRIGN----AkgdeALEKRFLDKALELHMISLKGHRSVGGVRVSLYNAVTIEDVQKLASFMKNFLEMH 368 rabbit
P91856       301 NVCFRIGG----PsgndELEEKFLKGSIERNMISLKGHRSVGGIRASLYNAISVEETQVLATWMNEFQKLH 367 Caenorhabditis elegans
Q10349       325 NVTFRIEP----Q----ELESEFLAEAEKHHLVQLKGYRSVGGIRASLYNAISVEQTRRLIDLLESFAKAH 387 Schizosaccharomyces pomb...
P81435       298 NVVFHLYN----S----KLDNLFLKEAKNAGLNALKGHNVIGGMRASIYNAMPLEGVQSLAKFMLYFEKKY 360 Buchnera aphidicola str....
Q96255       367 NVPFTLEK----S----ELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAFMKDFQAKH 429 thale cress
WP_010897357 298 NVTFTLPT----E----ELTQQFLSEAKEKGFVGLNGHRSVGGCRASIYNGVPVEACEALADFMHSFYQTH 360 Bacillus halodurans
WP_005722605 297 NVTFTTDN----D----ELNAKFVAEATAAGLHALKGHKVLGGMRASIYNAMPMEGVQALIAFMKQFEAEN 359 Pasteurella multocida
WP_002858670 294 NVSFNIAK----Nk---DLEPLFVKEAEEAGMIGLKGHRILGGIRASIYNALNLDQVKTLCEFMKEFQGKY 357 Campylobacter jejuni
WP_003129506 302 NVVFTSPS----Q----ELDELFTQKAEEKGFKSLKGHRSVGGMRASIYNAFPLEGVVELVKFMKEFEEGY 364 Lactococcus lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap