1FWN,1O60


Conserved Protein Domain Family
KDO8P_synth

?
TIGR01362: KDO8P_synth 
Click on image for an interactive view with Cn3D
3-deoxy-8-phosphooctulonate synthase
This model describes 3-deoxy-8-phosphooctulonate synthase. Alternate names include 2-dehydro-3-deoxyphosphooctonate aldolase, 3-deoxy-d-manno-octulosonic acid 8-phosphate and KDO-8 phosphate synthetase. It catalyzes the aldol condensation of phosphoenolpyruvate with D-arabinose 5-phosphate: phosphoenolpyruvate + D-arabinose 5-phosphate + H2O = 2-dehydro-3-deoxy-D-octonate 8-phosphate + phosphate In Gram-negative bacteria, this is the first step in the biosynthesis of 3-deoxy-D-manno-octulosonate, part of the oligosaccharide core of lipopolysaccharide. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 130429
View PSSM: TIGR01362
Aligned: 11 rows
Threshold Bit Score: 431.399
Threshold Setting Gi: 499221765
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FWN_A         2 EKFLVIAGPCAIESEELLLKVGEEIKRLSEK--FkEVEFVFKSSFDKANRSSIHSFRGHGLEYGVKALRKVKEEFGLKIT 79  Aquifex aeolicus
Q9ZE84        16 LQFVLIAGPCQIEGKDHALFMAEKLMKLTSK--L-SIPFIYKSSFDKANRTSINGIRGLGIEKGLEILSKVKSEFDCPII 92  Rickettsia prow...
P56060         9 PKSVLIAGPCVIESLENLRSIATKLQPLANn--E-RLDFYFKASFDKANRTSLESYRGPGLEKGLEMLQTIKEEFGYKIL 85  Helicobacter py...
O66496         2 EKFLVIAGPCAIESEELLLKVGEEIKRLSEKf-K-EVEFVFKSSFDKANRSSIHSFRGHGLEYGVKALRKVKEEFGLKIT 79  Aquifex aeolicu...
O68662        19 KPFTLFGGMNVLESRDMAMRVCEQYVEVTNK--L-GVPYVFKASFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVSII 95  Actinobacillus ...
WP_010893795  12 QPLFLIAGPCVIESLQLQLDTAGVLKEITSK--L-GLNFIFKSSFDKANRTSGSSFRGPGLEEGLKVLEAVKTQIGVPVL 88  Xylella fastidiosa
O50044        15 DPFFLLAGPNVIESEEHIMRMAKHIKTISSK--F-GIPLIFKSSFDKANRTSSKSFRGPGIVEGLKILEKVKIAYDIPIV 91  pea
WP_010883359   4 NKMILIAGPCVIEGEDITLEIAGKLQSILAPysD-RIQWFFKSSYDKANRSSLNSFRGPGLTEGLRILAKVKETFGVGIL 82  Chlamydia pneum...
WP_005874478  15 DSFFLMAGPCAIESEDMALRIAERIVEVTSR--L-GIPYIFKGSYRKANRSRIDSFTGIGDEKALRILGKVGREFGVPTV 91  Porphyromonas g...
WP_010919305  29 EKLSIIAGPCQMESRQHALETAHALKEMADR--L-GVGLIYKTSYDKANRTSANAQRGIGLKDSLAIFQEIREVTGLPTL 105 Caulobacter vib...
1O60_A        17 KPFVLFGGXNVLESRDXAXQVCEAYVKVTEK--L-GVPYVFKASFDKANRSSIHSYRGPGXEEGLKIFQELKDTFGVKII 93  Haemophilus inf...
1FWN_A        80 TDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAVNVKKGQFLAPWDTKNVVEKLKFGGA------------- 146 Aquifex aeolicus
Q9ZE84        93 TDVHSESQCIETAKVVDILQIPAFLCRQTDLLKAAAKTGKIVKVKKGQFLAPWDMKNVQKKLEVFGA------------- 159 Rickettsia prow...
P56060        86 TDVHESYQASVAAKVADILQIPAFLCRQTDLIVEVSQTNAIVNIKKGQFMNPKDMQYSVLKALKTRDksiqsptyetalk 165 Helicobacter py...
O66496        80 TDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAVNVKKGQFLAPWDTKN-VVEKLKFGGa------------ 146 Aquifex aeolicu...
O68662        96 TDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMARTGVVINVKKPQFLSPGQMGNIVEKIAECGN------------- 162 Actinobacillus ...
WP_010893795  89 TDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVCAVGKPVNIKKGQFLSPWDMKPVVEKAKSTGN------------- 155 Xylella fastidiosa
O50044        92 TDVHEASQCEPVGRVADIIQIPAFLCRQTDLLVAAAKTGKIINIKKGQFCAPSVMANSAEKVRLAGN------------- 158 pea
WP_010883359  83 TDVHTPQDAYAAAEVCNILQVPAFLCRQTDLLVATAETGAIVNLKKGQFLSPWDMEGPINKVLSTGN------------- 149 Chlamydia pneum...
WP_005874478  92 TDIHETHEAAMAAEYVDVLQIPAFLCRQTDLIVAAAYTGRIVNVKKGQFLSGEAMAFVARKCVDSGN------------- 158 Porphyromonas g...
WP_010919305 106 TDVHETSHCSIVAEAVDVIQIPAFLCRQTDLLVAAASTGRAINIKKGQFLAPWDMKNVIAKVTGAGN------------- 172 Caulobacter vib...
1O60_A        94 TDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAXAKTGAVINVKKPQFLSPSQXGNIVEKIEECGN------------- 160 Haemophilus inf...
1FWN_A       147 KEIYLTERGTTFGYNNLVVDFRSLPIM-KQ--W--AKVIYDATHSVQLPG-----GLGDKSGGMREFIFPLIRAAVAVGC 216 Aquifex aeolicus
Q9ZE84       160 KDILFTERGSCFGYNNLVSDMRSLAIMsEL--N--VPVVFDATHSVQQPG-----GRGGSSGGERKYVELLAKAAISVGI 230 Rickettsia prow...
P56060       166 NGVWLCERGSSFGYGNLVVDMRSLKIM-RE--F--APVIFDATHSVQMPG-----GANGKSSGDSSFAPILARAAAAVGI 235 Helicobacter py...
O66496       147 KEIYLTERGTTFGYNNLVVDFRSLPIM-KQ--W--AKVIYDATHSVQLPG-----GLGDKSGGMREFIFPLIRAAVAVGC 216 Aquifex aeolicu...
O68662       163 ENVILCDRGTNFGYDNLVVDMLGFNIMkKV--SkgCPVIFDVTHSLQCRD-----PFGAASGGRRDQVTELARSGMAIGL 235 Actinobacillus ...
WP_010893795 156 SQILVCERGASFGYNNLVSDMRSLAVMrET--G--CPVVFDATHSVQLPG-----AQGGRSGGQREFVPVLARAAVAVGI 226 Xylella fastidiosa
O50044       159 PNVMVCERGTMFGYNDLIVDPRNLEWMrEA--N--CPVVADITHSLQQPAgkkldGGGVASGGLRELIPCIARTSVAVGV 234 pea
WP_010883359 150 NKILLTERGCSFGYNNLVSDMRSIPVLsRS--G--FPVIFDATHSVQLPG-----ALSTESGGLTEFVPTLSRAALAAGA 220 Chlamydia pneum...
WP_005874478 159 SQVILTERGNTFGYTDLVVDYRNIPAMrSL--G--FPVVMDVTHSLQQPN-----QGSGVTGGKPELIETIAKAAIAVGA 229 Porphyromonas g...
WP_010919305 173 PNVMACERGASFGYNTLVSDMRALPIMkEI--G--CPVVFDATHSVQQPG-----GQGTSSGGQREFVPTLARAAVAVGV 243 Caulobacter vib...
1O60_A       161 DKIILCDRGTNFGYDNLIVDXLGFSVXkKAskG--SPVIFDVTHSLQCRD-----PFGAASSGRRAQVTELARSGLAVGI 233 Haemophilus inf...
1FWN_A       217 DGVFMETHPEPEKALSDASTQLPLSQLEGIIEAILEIREVASK 259 Aquifex aeolicus
Q9ZE84       231 AGIYMEVHQDPDNAPSDGPCMIKLDNLESILIKLKKYDKITKE 273 Rickettsia prowazekii str. Madrid E
P56060       236 DGLFAETHVDPKNALSDGANMLKPDELEQLVTDMLKIQNLF-- 276 Helicobacter pylori 26695
O66496       217 DGVFMETHPEPEKALSDASTQLPLSQLEGIIEAILEIREVASK 259 Aquifex aeolicus VF5
O68662       236 AGLFLEAHPDPNSAKCDGPSALPLSKLEAFVSQMKAIDDLVKS 278 Actinobacillus pleuropneumoniae
WP_010893795 227 SGLFAETHPDPPNALSDGPNAWPLHTMAMLLETLVELDAVTKK 269 Xylella fastidiosa
O50044       235 DGIFMEVHDDPLNAPVDGPTQWPLRHLEELLEELIAISRVSKG 277 pea
WP_010883359 221 HGLFIETHTNPKIAKSDAASMLSLEEFAALLPTWDQLFTCVSS 263 Chlamydia pneumoniae
WP_005874478 230 DGLFIETHPDPASAKSDGANMLRLDLLEGLLTKLMRIRAAIRD 272 Porphyromonas gingivalis
WP_010919305 244 ACVFIETHPDPDNAPSDGPNMVPVKEFEALVANLLRYDALTKA 286 Caulobacter vibrioides
1O60_A       234 AGLFLEAHPNPNQAKCDGPSALPLSALEGFVSQXKAIDDLVKS 276 Haemophilus influenzae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap