2BWJ,3ADK


Conserved Protein Domain Family
aden_kin_iso1

?
TIGR01360: aden_kin_iso1 
Click on image for an interactive view with Cn3D
adenylate kinase, isozyme 1 subfamily
Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Statistics
?
PSSM-Id: 130427
View PSSM: TIGR01360
Aligned: 6 rows
Threshold Bit Score: 344.877
Threshold Setting Gi: 13873330
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BWJ_A    10 RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLG 89  human
P05081     7 KHHKIIFVVGGPGSGKGTQCEKIVHKYGYTHLSTGDLLRAEVSSGSERGKKLQAIMEKGELVPLDTVLDMLRDAMLAKAD 86  chicken
BAB44153   2 ADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKG 81  fruit fly
Q9Y6K8   374 RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLG 453 human
Q20140    18 AGVPIFFIVGGPGSGKGTQCDKIVAKYGLTHLSSGDLLRDEVKSGSPRGAQLTAIMESGALVPLEVVLDLVKEAMLKAIE 97  Caenorhabditis elegans
3ADK_A     7 KKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVD 86  pig
2BWJ_A    90 D-TRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQMSRSSL--PVDDTTKTIAKRLEAYYRASIPVIA 166 human
P05081    87 T-SKGFLIDGYPREVKQGEEFEKKIAPPTLLLYVDAGKETMVKRLLKRGETSG--RVDDNEETIKKRLETYYKATEPVIA 163 chicken
BAB44153  82 S-SKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAvkRDDDNEKTIRARLLTFKQNTNAILE 160 fruit fly
Q9Y6K8   454 D-TRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSL--PVDDTTKTIAKRLEAYYRASIPVIA 530 human
Q20140    98 KgSKGFLIDGYPREVAQGQQFESEIQEAKLVLFFDVAEETLVKRLLHRAQTSG--RADDNADTIKKRLHTFVTSTAPVVD 175 Caenorhabditis elegans
3ADK_A    87 T-SKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPETMTKRLLKRGETSG--RVDDNEETIKKRLETYYKATEPVIA 163 pig
2BWJ_A   167 YYETKTQLHKINAEGTPEDVFLQLCTAIDSI 197 human
P05081   164 FYKGRGIVRQLNAEGTVDEVFQQVCSYLDKL 194 chicken
BAB44153 161 LYEP--KTLTINAERDVDDIFLEVVQAIDCV 189 fruit fly
Q9Y6K8   531 YYETKTQLHKINAEGTPEDVFLQLCTAIDSI 561 human
Q20140   176 YYESKGKLVRINAEGSVDDIFAVVVANLDKA 206 Caenorhabditis elegans
3ADK_A   164 FYEKRGIVRKVNAEGSVDDVFSQVCTHLDTL 194 pig
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap