Conserved Protein Domain Family
DAHP_synth_II

?
TIGR01358: DAHP_synth_II 
3-deoxy-7-phosphoheptulonate synthase, class II
This model represents the class II family of 3-deoxy-7-phosphoheptulonate synthase, aka phospho-2-dehydro-3-deoxyheptonate aldolase, as found in plants and some bacteria. It shows some similarity to the class I family found in many bacteria. The enzyme catalyzes the first of 7 steps in the biosynthesis of chorismate, that last common precursor of all three aromatic amino acids. Homologs scoring between trusted and noise cutoff include proteins involved in antibiotic biosynthesis; one example is active as this enzyme, while another acts on an amino analog. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 130425
View PSSM: TIGR01358
Aligned: 6 rows
Threshold Bit Score: 792.812
Threshold Setting Gi: 490015019
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB38581      36 WTPGSWRSRPAAQQP-EWPDPGELRGVEDTLALRPPLVLPDEILDLRRSLAQVAAGEGFLLQAGDCAERFGSCTEAGVRG 114 Streptomyces co...
AAK14074      30 WSPQSWRQRTALQMP-TYPDAAALEHTLDELRQLPPLVTSWEIFALKRQLAEAQEGKRFLLQGGDCAENFSDCESGTISN 108 Xanthomonas cam...
P80574        10 SAGNTWRDLPAAQQP-EYPDTEALRAVIADLESYPPLVFAGECDQLRARMAAVAKGEAFLLQGGDCAEAFDAVSADHIRN 88  Streptomyces co...
Q00218        52 WSLESWKSKKALQLP-DYPDQKDVDSVLQTLSSFPPIVFAGEARKLEDKLGQAAMGQAFMLQGGDCAESFKEFNANNIRD 130 thale cress
WP_010920159   5 WTPAAWRAKPAKHLPtDYPDMGAVERVEQTLRQMPPLVFAGEARRLKSQLGEVAEGRAFLLQGGDCAESFKEFHADNIRD 84  Caulobacter vib...
WP_003917601  24 TRLDAALAKPAAQQP-TWP-ADRALAMRTVLESVPPVTVPSEIVRLQEQLAQVAKGEAFLLQGGDCAETFMDNTEPHIRG 101 Mycobacterium t...
CAB38581     115 KLRVILQVAILLTYGSGLPVVKVGRIAGQFGKPRSRPTEAVDGVELPVYRGDIVNGPEFTAEARRPDAGRLLSAYHHASA 194 Streptomyces co...
AAK14074     109 RLKVLLQMSLVLVHGLRLPVVRVGRFAGQYAKPRSADTETRDGVTLPSYRGDVINAPAFTEAARVPDPRRMITAHSRSAM 188 Xanthomonas cam...
P80574        89 KLKTLLQMGAVLTYAASVPVVKVGRIAGQYSKPRSKPTETRDGVTLPTYRGDSVNGFDFTEAARIPDPERLKRMYHASAS 168 Streptomyces co...
Q00218       131 TFRVLLQMGVVLMFGGQLPVIKVGRMAGQFAKPRSDPFEEKDGVKLPSYRGDNINGDAFDEKSRIPDPHRMVRAYTQSVA 210 thale cress
WP_010920159  85 TFRLILQMAVVLTFAGGKPVVKVGRIAGQFAKPRSEPIEVQGDVTLPSYRGDIINGMDFNEAERVPDPDRLLKAYGQSAA 164 Caulobacter vib...
WP_003917601 102 NVRALLQMAVVLTYGASMPVVKVARIAGQYAKPRSADIDALG---LRSYRGDMINGFAPDAAAREHDPSRLVRAYANASA 178 Mycobacterium t...
CAB38581     195 ALNVLRALTLGGYADLGQVHEWNQEFVRRSPAGQRYEKAADDITWALRFMSACGLDTRSqaALHQVQLYTSHEALLPQYE 274 Streptomyces co...
AAK14074     189 TMNFVRALIDGGFADLHHPEYWNLQWVGYSPLAADYQKMVSSIGDAVRFMETLSGAEVY--NLNRIDFYTSHEALLLPYE 266 Xanthomonas cam...
P80574       169 TLNLVRAFTTGGYADLRQVHAWNQDFVKSSPSGQRYEQLAREIDNALNFMRACGTDPAE---FQTVEFFSSHEALLLDYE 245 Streptomyces co...
Q00218       211 TLNLLRAFATGGYAAMQRVSQWNLDFTQHSEQGDRYRELANRVDEALGFMGAAGLTSAHp-IMTTTEFWTSHECLLLPYE 289 thale cress
WP_010920159 165 TLNLLRAFASGGYADLYNIHRWTLGFVGDSPQGARYRELSEKISEALTFMSAVGVTPDTqpDLRRVEFFTSHEALLLGFE 244 Caulobacter vib...
WP_003917601 179 AMNLVRALTSSGLASLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSACGVADRN---LQTAEIYASHEALVLDYE 255 Mycobacterium t...
CAB38581     275 QALIRYDE---KRRGWFDTSAHLLWIGDRTRRVDGAHVELLAGVDNPVGVKVGPTMGVDDLRELCERLDPDRAPGRLVLI 351 Streptomyces co...
AAK14074     267 EGLTRQVP---RQWGWFNLSTHYPWIGMRTRQLDGAHVEYLRGVRNPIAIKVGPSVQPDQLLRLMDVLNPEDEPGRLSFI 343 Xanthomonas cam...
P80574       246 SALTRVDS---RTGQLYDVSGHMVWIGERTRQLDHAHIEFASRIRNPIGIKLGPSTTAEEALQYIERLDPEREPGRLTFI 322 Streptomyces co...
Q00218       290 QALTREDS---TSGLYYDCSAHMLWVGERTRQLDGAHVEFLRGIANPLGIKVSDKMVPSELVKLIEILNPQNKPGRITVI 366 thale cress
WP_010920159 245 EAMTRVDS---TSGDWYDTSAHLLWIGERTRQLDGAHVEFMRGVKNPIGLKCGPTMEGDDLLRLIDVLNPHNEPGRLTLY 321 Caulobacter vib...
WP_003917601 256 RAMLRLSDgedGEPQLFDLSAHTVWIGERTRQIDGAHIAFAQVIANPVGVKLGPNMTPELAVEYVERLDPHNKPGRLTLV 335 Mycobacterium t...
CAB38581     352 SRLGAGRGAELLPPLLRAVRDAGHAPVWACDPMHGNTFVSASGYKTRRLSDITTEVAEFFAVHREEGLHPGGIHLELTGD 431 Streptomyces co...
AAK14074     344 HRMGAAQIAEKLPPLLDAVKRDGRRVLWVCDAMHGNTESTGNGYKTRRFDNIRSEVELSFDLHAAAGTRLGGVHLELTGE 423 Xanthomonas cam...
P80574       323 VRMGADKIRDKLPELVEKVTASGATVAWITDPMHGNTYEAASGHKTRRFDDVLDEVKGFFEVHKSLGTHPGGIHVELTGD 402 Streptomyces co...
Q00218       367 VRMGAENMRVKLPNLIRAVRGAGQIVTWVSDPMHGNTIMAPGGLKTRSFDAIRAELRAFFDVHDQEGSFPGGVHLEMTGQ 446 thale cress
WP_010920159 322 GRFGSDKIADRLPRLMKATKSAGRSVVWATDPMHGNTLKASTGYKTRPFDRILSEVKSFVEIAQAEGVHPGGVHLEMTGQ 401 Caulobacter vib...
WP_003917601 336 SRMGNHKVRDLLPPIVEKVQATGHQVIWQCDPMHGNTHESSTGFKTRHFDRIVDEVQGFFEVHRALGTHPGGIHVEITGE 415 Mycobacterium t...
CAB38581     432 DVTECLGGdLDEVLDTHLASRYETACDPRLNAAQSIELAFGVARLLRELR 481 Streptomyces coelicolor A3(2)
AAK14074     424 DVTECTGG-ARELTERDLERAYRSSVDPRLNYEQSLEIAMAIVRKQQQVA 472 Xanthomonas campestris
P80574       403 DVTECVGG-GDEIFVDDLHQRYETACDPRLNRSQSLDLAFLVAEMYRDQ- 450 Streptomyces coelicolor A3(2)
Q00218       447 NVTECVGG-SRTITYNDLSSRYHTHCDPRLNASQSLELAFIIAERLRKRR 495 thale cress
WP_010920159 402 NVTECLGG-ARAVSETDLADRYHTHCDPRLNGEQALELAFLVAEKLKAAR 450 Caulobacter vibrioides
WP_003917601 416 NVTECLGG-AQDISETDLAGRYETACDPRLNTQQSLELAFLVAEMLRD-- 462 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap