3URH


Conserved Protein Domain Family
lipoamide_DH

?
TIGR01350: lipoamide_DH 
Click on image for an interactive view with Cn3D
dihydrolipoamide dehydrogenase
This model describes dihydrolipoamide dehydrogenase, a flavoprotein that acts in a number of ways. It is the E3 component of dehydrogenase complexes for pyruvate, 2-oxoglutarate, 2-oxoisovalerate, and acetoin. It can also serve as the L protein of the glycine cleavage system. This family includes a few members known to have distinct functions (ferric leghemoglobin reductase and NADH:ferredoxin oxidoreductase) but that may be predicted by homology to act as dihydrolipoamide dehydrogenase as well. The motif GGXCXXXGCXP near the N-terminus contains a redox-active disulfide.
Statistics
?
PSSM-Id: 273568
Aligned: 19 rows
Threshold Bit Score: 569.583
Threshold Setting Gi: 499168244
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3URH_A        25 AYDLIVIGSGPGGYVCAIKAAQLGXKVAVVEKrSTYGGTCLNVGCIPSKALLHASEXFHQAQHgLEALGv--eVAN--PK 100 Sinorhizobium m...
BAB04498       3 SYDIVVIGGGPGGYVAAIKAAKLGKKVALVEA-KDLGGTCLNRGCIPSKTLLHQGEIIEKIKQ-AKEWG----IETgaVT 76  Bacillus halodu...
AAA21748     115 GDNLVVIGGGPGGYVAAIRAAQLGAKVTLIEK-ESLGGTCLNVGCIPTKVLLHSSQLLTEMKE-GDKLGi--dIEGs-IV 189 Clostridium magnum
CAC47627       2 AYDLIVIGSGPGGYVCAIKAAQLGMKVAVVEKrSTYGGTCLNVGCIPSKALLHASEMFHQAQHgLEALGv--eVAN--PK 77  Sinorhizobium m...
P21880         9 ETDTLVIGAGPGGYVAAIRAAQLGQKVTVVEK-ATLGGVCLNVGCIPSKALINAGHRYENAKH-SDDMGi--tAEN--VT 82  Bacillus subtil...
WP_010897986   1 MDRVAIVGGGPAGYVAAITAAHRGKQVTLIEQ-KKLGGTCLNEGCMPTKSLLESAATYDKVKH-ASDYGikgpVDE--MR 76  Bacillus halodu...
WP_010896398   9 evdtvvvgggpggYTAAIRLGQLGKSVVLIEK-NQLGGVCLNRGCIPSKALIQMAEKFDELTH-LKEMGv--eLPGkpAS 84  Bacillus halodu...
AAK39968      10 SYDVIVIGGGPGGYVCSIRCAQNKLNVLNVNEdKKLGGTCLNRGCIPSKSLLHISHNYYEAKTrFKECGi--lVDN--VK 85  malaria parasit...
WP_000292284   9 AFDIVVIGGGPAGYVAAIKAAQFGGKVALVEK-SELGGTCLNRGCIPTKTYLHNAEIIENIGH-AANRGi--vIENpnFT 84  Streptococcus p...
WP_004083198   1 MYDAVIIGGGPGGYVCAIKLAQLGKKVALVEK-DALGGTCTNRGCIPTKAMLTVSHLMDEMKEkASKYGl--kVSG--VE 75  Thermotoga mari...
BAB04498       3 SYDIVVIGGGPGGYVAAIKAAKLGKKVALVEA-KDLGGTCLNRGCIPSKTLLHQGEIIEKIKQ-AKEWG----IETgaVT 76  Bacillus halodu...
AAA21748     115 GDNLVVIGGGPGGYVAAIRAAQLGAKVTLIEK-ESLGGTCLNVGCIPTKVLLHSSQLLTEMKE-GDKLGi--dIEGs-IV 189 Clostridium magnum
CAC47627       2 AYDLIVIGSGPGGYVCAIKAAQLGMKVAVVEKrSTYGGTCLNVGCIPSKALLHASEMFHQAQHgLEALGv--eVAN--PK 77  Sinorhizobium m...
P21880         9 ETDTLVIGAGPGGYVAAIRAAQLGQKVTVVEK-ATLGGVCLNVGCIPSKALINAGHRYENAKH-SDDMGi--tAEN--VT 82  Bacillus subtil...
WP_010897986   1 MDRVAIVGGGPAGYVAAITAAHRGKQVTLIEQ-KKLGGTCLNEGCMPTKSLLESAATYDKVKH-ASDYGikgpVDE--MR 76  Bacillus halodu...
WP_010896398   9 evdtvvvgggpggYTAAIRLGQLGKSVVLIEK-NQLGGVCLNRGCIPSKALIQMAEKFDELTH-LKEMGv--eLPGkpAS 84  Bacillus halodu...
AAK39968      10 SYDVIVIGGGPGGYVCSIRCAQNKLNVLNVNEdKKLGGTCLNRGCIPSKSLLHISHNYYEAKTrFKECGi--lVDN--VK 85  malaria parasit...
WP_000292284   9 AFDIVVIGGGPAGYVAAIKAAQFGGKVALVEK-SELGGTCLNRGCIPTKTYLHNAEIIENIGH-AANRGi--vIENpnFT 84  Streptococcus p...
WP_004083198   1 MYDAVIIGGGPGGYVCAIKLAQLGKKVALVEK-DALGGTCTNRGCIPTKAMLTVSHLMDEMKEkASKYGl--kVSG--VE 75  Thermotoga mari...
3URH_A       101 LNLQKXXAHKDATVKSNVDGVSFLFKKNKIDGFQGTGKVLGQGKVSVTNEKgEe-QVLEAKNVVIATGSDVAGIPGvE-- 177 Sinorhizobium m...
BAB04498      77 LSLPKMLARKNEIIQKLRAGIHFLLKQGKIDVYFGYGEIERDRSVKIKMKEtAeiVSVRTENMIVATGTEPTIPPV-Pg- 154 Bacillus halodu...
AAA21748     190 VNWKHIQKRKKIVIKKLVSGVSGLLTCNKVKVIKGTAKFESKDTILVTKED-GvaEKVNFDNAIIATGSMPFIPEI-Eg- 266 Clostridium magnum
CAC47627      78 LNLQKMMAHKDATVKSNVDGVSFLFKKNKIDGFQGTGKVLGQGKVSVTNEKgEe-QVLEAKNVVIATGSDVAGIPG-Ve- 154 Sinorhizobium m...
P21880        83 VDFTKVQEWKASVVNKLTGGVAGLLKGNKVDVVKGEAYFVDSNSVRVMDENsA--QTYTFKNAIIATGSRPIELPN---- 156 Bacillus subtil...
WP_010897986  77 IEWGQVQARKNQIVHQLVKGIDYLLKKHKIELLEGTASFQSAHELLVQTERgQ--QTIEANRIIIATGSEPTPLPF-A-- 151 Bacillus halodu...
WP_010896398  85 IDLHKWQKWKQEITTKLNTGIHQLCQQNGVTVVTGEAHFLSSHRVGVETGNaF--DVYKFEHAIVATGSSPRSLPF-A-- 159 Bacillus halodu...
AAK39968      86 LDIETMHKHKNKCMGNLSDGINFLYKKNNVNHIIGHGSLVDEHTVLIKTEK-Ee-KKVTAERIVIATGSKPIEIPL-Kkl 162 malaria parasit...
WP_000292284  85 VDMEKLLETKSKVVNTLVGGVAGLLRSYGVTVHKGIGTITKDKNVLVNGS-----ELLETKKIILAGGSKVSKINV-P-- 156 Streptococcus p...
WP_004083198  76 YDVAAIMKHVQKSVMMSRKGIEYLLKKNGVEVFKGTAVVENKNTVVVQETG----EKLEAKNLVLAHGSVPSVFS--P-- 147 Thermotoga mari...
BAB04498      77 LSLPKMLARKNEIIQKLRAGIHFLLKQGKIDVYFGYGEIERDRSVKIKMKEtAeiVSVRTENMIVATGTEPTIPPV-Pg- 154 Bacillus halodu...
AAA21748     190 VNWKHIQKRKKIVIKKLVSGVSGLLTCNKVKVIKGTAKFESKDTILVTKED-GvaEKVNFDNAIIATGSMPFIPEI-Eg- 266 Clostridium magnum
CAC47627      78 LNLQKMMAHKDATVKSNVDGVSFLFKKNKIDGFQGTGKVLGQGKVSVTNEKgEe-QVLEAKNVVIATGSDVAGIPG-Ve- 154 Sinorhizobium m...
P21880        83 VDFTKVQEWKASVVNKLTGGVAGLLKGNKVDVVKGEAYFVDSNSVRVMDENsA--QTYTFKNAIIATGSRPIELPN---- 156 Bacillus subtil...
WP_010897986  77 IEWGQVQARKNQIVHQLVKGIDYLLKKHKIELLEGTASFQSAHELLVQTERgQ--QTIEANRIIIATGSEPTPLPF-A-- 151 Bacillus halodu...
WP_010896398  85 IDLHKWQKWKQEITTKLNTGIHQLCQQNGVTVVTGEAHFLSSHRVGVETGNaF--DVYKFEHAIVATGSSPRSLPF-A-- 159 Bacillus halodu...
AAK39968      86 LDIETMHKHKNKCMGNLSDGINFLYKKNNVNHIIGHGSLVDEHTVLIKTEK-Ee-KKVTAERIVIATGSKPIEIPL-Kkl 162 malaria parasit...
WP_000292284  85 VDMEKLLETKSKVVNTLVGGVAGLLRSYGVTVHKGIGTITKDKNVLVNGS-----ELLETKKIILAGGSKVSKINV-P-- 156 Streptococcus p...
WP_004083198  76 YDVAAIMKHVQKSVMMSRKGIEYLLKKNGVEVFKGTAVVENKNTVVVQETG----EKLEAKNLVLAHGSVPSVFS--P-- 147 Thermotoga mari...
3URH_A       178 --------------VAFDEktIVSSTGALALEKVPASXIVVGGGVIGLELGSVWARLGAKVTVVEFLDTILGGXDGEVAK 243 Sinorhizobium m...
BAB04498     155 --------------LAEAV--VDTSDTIFELDSIPQSIVIIGGGVIGVEIACIFSSLQVDVTIVEMGKRILPQEDEEAAK 218 Bacillus halodu...
AAA21748     267 --------------NKLSG--VIDSTGALSLESNPESIAIIGGGVIGVEFASIFNSLGCKVSIIEMLPHILPPMDREISE 330 Clostridium magnum
CAC47627     155 --------------VAFDEktIVSSTGALALEKVPASMIVVGGGVIGLELGSVWARLGAKVTVVEFLDTILGGMDGEVAK 220 Sinorhizobium m...
P21880       157 --------------FKYSe-rVLNSTGALALKEIPKKLVVIGGGYIGTELGTAYANFGTELVILEGGDEILPGFEKQMSS 221 Bacillus subtil...
WP_010897986 152 ---------------PFDRewVISSEQAMSLPIQPESMIIVGGGVIGCEFASIYGRMGTKVTIIEMADRLLFGEDHDICK 216 Bacillus halodu...
WP_010896398 160 ---------------EVDHtyILDSTSALELTEVPRSLSIVGGGYIGMELGLAFAKLGSAVTIVEMSPHILPATAPHISR 224 Bacillus halodu...
AAK39968     163 ndnnfndadnvndiLEYDHeiIQNSDDILNFKKVPHNISIIGGGVIGLEIGSVFSKLGSDVTVFEYNERLCGFLDADVSK 242 malaria parasit...
WP_000292284 157 ---------------GMESplVMTSDDILEMNEVPESLVIIGGGVVGIELGQAFMTFGSKVTVIEMMDRIVPAMDVEVSK 221 Streptococcus p...
WP_004083198 148 --------------FDIDG--VWTSDDVFNLKEFPKSLVIVGGGVIGVEFATFFGSFGVDVTIVEIAEHILPYEDSDVAE 211 Thermotoga mari...
BAB04498     155 --------------LAEAV--VDTSDTIFELDSIPQSIVIIGGGVIGVEIACIFSSLQVDVTIVEMGKRILPQEDEEAAK 218 Bacillus halodu...
AAA21748     267 --------------NKLSG--VIDSTGALSLESNPESIAIIGGGVIGVEFASIFNSLGCKVSIIEMLPHILPPMDREISE 330 Clostridium magnum
CAC47627     155 --------------VAFDEktIVSSTGALALEKVPASMIVVGGGVIGLELGSVWARLGAKVTVVEFLDTILGGMDGEVAK 220 Sinorhizobium m...
P21880       157 --------------FKYSe-rVLNSTGALALKEIPKKLVVIGGGYIGTELGTAYANFGTELVILEGGDEILPGFEKQMSS 221 Bacillus subtil...
WP_010897986 152 ---------------PFDRewVISSEQAMSLPIQPESMIIVGGGVIGCEFASIYGRMGTKVTIIEMADRLLFGEDHDICK 216 Bacillus halodu...
WP_010896398 160 ---------------EVDHtyILDSTSALELTEVPRSLSIVGGGYIGMELGLAFAKLGSAVTIVEMSPHILPATAPHISR 224 Bacillus halodu...
AAK39968     163 ndnnfndadnvndiLEYDHeiIQNSDDILNFKKVPHNISIIGGGVIGLEIGSVFSKLGSDVTVFEYNERLCGFLDADVSK 242 malaria parasit...
WP_000292284 157 ---------------GMESplVMTSDDILEMNEVPESLVIIGGGVVGIELGQAFMTFGSKVTVIEMMDRIVPAMDVEVSK 221 Streptococcus p...
WP_004083198 148 --------------FDIDG--VWTSDDVFNLKEFPKSLVIVGGGVIGVEFATFFGSFGVDVTIVEIAEHILPYEDSDVAE 211 Thermotoga mari...
3URH_A       244 QLQRXLTKQG-IDFKLGAKVTgaVKSGDGAKVT---FEPvKGGe-aTTLDAEVVLIATGRKPSTDglGLAKAGVVLDSrG 318 Sinorhizobium m...
BAB04498     219 VLAKALAAKG-VHLLTNTKVT--AVLQGDKQKVeieTST-GDR---DWLEGERILLAVGRTPNLS--VVKELGLGMAG-P 288 Bacillus halodu...
AAA21748     331 IAKAKLIRDG-ININNNCKVT--RIEQGEDGLKvsfIGD-KGE---ESIDVEKVLIAVGRRSNIEglDVEKIGVKTEG-G 402 Clostridium magnum
CAC47627     221 QLQRMLTKQG-IDFKLGAKVTgaVKSGDGAKVT---FEP-VKGgeaTTLDAEVVLIATGRKPSTDglGLAKAGVVLDSrG 295 Sinorhizobium m...
P21880       222 LVTRRLKKKGnVEIHTNAMAK--GVEERPDGVTv-tFE--VKge-eKTVDADYVLITVGRRPNTDelGLEQVGIEMTDrG 295 Bacillus subtil...
WP_010897986 217 VLMEELKRQG-VEIYPSTVIK--EMQRDRKQVV---VER-DGQv--EVLTGDYVLVAIGRKPRLQeiGLERIGVDFTSrG 287 Bacillus halodu...
WP_010896398 225 EVLNKAEKLG-VTIKSSTSVE--HLTVNDGYVEl--IVQ-SNGe-qETLQSEKALMTVGRSPNTKglGLEQVGVFFNEdG 297 Bacillus halodu...
AAK39968     243 VLQKTLEKIK-MKFVFNTSVIggNIENNQAALF---AKN-KKTneiKKTTSEIVLICIGRKANFDnlNLHLLNIELNKnK 317 malaria parasit...
WP_000292284 222 NLRLILERKG-MTILTGTKLQ--EIIEENGQLR---IKV-EGK---DDIIASKALLSIGRMPDLEgiG--EVEFELDr-G 288 Streptococcus p...
WP_004083198 212 EVKKALKRKG-VKILEKTKIS--SLSKVDDGFE---VAL-ENGe---TLKAEKVLLAAGRKPNIPe-DVKALGVKIEK-- 278 Thermotoga mari...
BAB04498     219 VLAKALAAKG-VHLLTNTKVT--AVLQGDKQKVeieTST-GDR---DWLEGERILLAVGRTPNLS--VVKELGLGMAG-P 288 Bacillus halodu...
AAA21748     331 IAKAKLIRDG-ININNNCKVT--RIEQGEDGLKvsfIGD-KGE---ESIDVEKVLIAVGRRSNIEglDVEKIGVKTEG-G 402 Clostridium magnum
CAC47627     221 QLQRMLTKQG-IDFKLGAKVTgaVKSGDGAKVT---FEP-VKGgeaTTLDAEVVLIATGRKPSTDglGLAKAGVVLDSrG 295 Sinorhizobium m...
P21880       222 LVTRRLKKKGnVEIHTNAMAK--GVEERPDGVTv-tFE--VKge-eKTVDADYVLITVGRRPNTDelGLEQVGIEMTDrG 295 Bacillus subtil...
WP_010897986 217 VLMEELKRQG-VEIYPSTVIK--EMQRDRKQVV---VER-DGQv--EVLTGDYVLVAIGRKPRLQeiGLERIGVDFTSrG 287 Bacillus halodu...
WP_010896398 225 EVLNKAEKLG-VTIKSSTSVE--HLTVNDGYVEl--IVQ-SNGe-qETLQSEKALMTVGRSPNTKglGLEQVGVFFNEdG 297 Bacillus halodu...
AAK39968     243 VLQKTLEKIK-MKFVFNTSVIggNIENNQAALF---AKN-KKTneiKKTTSEIVLICIGRKANFDnlNLHLLNIELNKnK 317 malaria parasit...
WP_000292284 222 NLRLILERKG-MTILTGTKLQ--EIIEENGQLR---IKV-EGK---DDIIASKALLSIGRMPDLEgiG--EVEFELDr-G 288 Streptococcus p...
WP_004083198 212 EVKKALKRKG-VKILEKTKIS--SLSKVDDGFE---VAL-ENGe---TLKAEKVLLAAGRKPNIPe-DVKALGVKIEK-- 278 Thermotoga mari...
3URH_A       319 RVEIDRHFQTSIAG-VYAIGDVVRGPXLAHKAEDEGVAVAEIIAGQAG-------HVNYDVIPGVVYTQPEVASVGKTEE 390 Sinorhizobium m...
BAB04498     289 FLKVDDQMRTSDPS-IYAIGDVIGGWQLAHVASAEGLVAAANASGKVE-------IINRQVIPRCIYTQPEIASVGLTEQ 360 Bacillus halodu...
AAA21748     403 SIIVNDKMETNVEG-IYAIGDCTGKIMLAHVASDQGVVAAENIMGQNK-------KMDYKTVPACVYTKPELASVGLTEE 474 Clostridium magnum
CAC47627     296 RVEIDRHFQTSIAG-VYAIGDVVRGPMLAHKAEDEGVAVAEIIAGQAG-------HVNYDVIPGVVYTQPEVASVGKTEE 367 Sinorhizobium m...
P21880       296 IVKTDKQCRTNVPN-IYAIGDIIEGPPLAHKASYEGKIAAEAIAG-EPa------EIDYLGIPAVVFSEPELASVGYTEA 367 Bacillus subtil...
WP_010897986 288 -ITVNEHMQTTIPH-IYACGDVIGGIQLAHVAFHEGSVAAKHLCG-EPi------QVRYEAVPRCIYTSPEIATVGLTET 358 Bacillus halodu...
WP_010896398 298 TLPINEECRTNIDH-IFAIGDVTEGPALAHKASKQGIVAAEVIGG-LPs------AIDSSYIPYVVFTDPQIAGVGLTAK 369 Bacillus halodu...
AAK39968     318 KIPVDEYFNVIAQPtIKAIGDAIDGPMLAHKAEEEGYLLANILFDELKnnkkkkaHINYDLVPSVIYTHPEVATVGYNEA 397 malaria parasit...
WP_000292284 289 CIKVNEYMETSVPG-IYAPGDINGTKMLAHAAFRMGEVSAENALKGNHa------VAKLNLTPAAIYTLPEVAAVGLTEE 361 Streptococcus p...
WP_004083198 279 GVVTDSRMRTNVEN-VYAIGDIRSGIMLAHVAMYEGIVAAKNIAGEEE-------EMDYSAVPSIIFSSPEVASVGVREK 350 Thermotoga mari...
BAB04498     289 FLKVDDQMRTSDPS-IYAIGDVIGGWQLAHVASAEGLVAAANASGKVE-------IINRQVIPRCIYTQPEIASVGLTEQ 360 Bacillus halodu...
AAA21748     403 SIIVNDKMETNVEG-IYAIGDCTGKIMLAHVASDQGVVAAENIMGQNK-------KMDYKTVPACVYTKPELASVGLTEE 474 Clostridium magnum
CAC47627     296 RVEIDRHFQTSIAG-VYAIGDVVRGPMLAHKAEDEGVAVAEIIAGQAG-------HVNYDVIPGVVYTQPEVASVGKTEE 367 Sinorhizobium m...
P21880       296 IVKTDKQCRTNVPN-IYAIGDIIEGPPLAHKASYEGKIAAEAIAG-EPa------EIDYLGIPAVVFSEPELASVGYTEA 367 Bacillus subtil...
WP_010897986 288 -ITVNEHMQTTIPH-IYACGDVIGGIQLAHVAFHEGSVAAKHLCG-EPi------QVRYEAVPRCIYTSPEIATVGLTET 358 Bacillus halodu...
WP_010896398 298 TLPINEECRTNIDH-IFAIGDVTEGPALAHKASKQGIVAAEVIGG-LPs------AIDSSYIPYVVFTDPQIAGVGLTAK 369 Bacillus halodu...
AAK39968     318 KIPVDEYFNVIAQPtIKAIGDAIDGPMLAHKAEEEGYLLANILFDELKnnkkkkaHINYDLVPSVIYTHPEVATVGYNEA 397 malaria parasit...
WP_000292284 289 CIKVNEYMETSVPG-IYAPGDINGTKMLAHAAFRMGEVSAENALKGNHa------VAKLNLTPAAIYTLPEVAAVGLTEE 361 Streptococcus p...
WP_004083198 279 GVVTDSRMRTNVEN-VYAIGDIRSGIMLAHVAMYEGIVAAKNIAGEEE-------EMDYSAVPSIIFSSPEVASVGVREK 350 Thermotoga mari...
3URH_A       391 ELKAAGVAYKIGKFPFTANGRARAXLQTDGFVKILADKETDRVLGGHIIGFGAGEXIHEIAVLXEFGGSSEDLGRTCHAH 470 Sinorhizobium m...
BAB04498     361 EAKEKGYSYKVVKVDLRANGKAMALGETTGFVKMIADPNYGEILGVTMVGPHVTEMIGEPAAFIHLEGTVDELKAMIHPH 440 Bacillus halodu...
AAA21748     475 QAKEKGIDYKVGKFQLAANGKSLIMNETGGVIKIITDKKYEEILGVHILGPRATDLITEAALALRLEATLEEIITTVHAH 554 Clostridium magnum
CAC47627     368 ELKAAGVAYKIGKFPFTANGRARAMLQTDGFVKILADKETDRVLGGHIIGFGAGEMIHEIAVLMEFGGSSEDLGRTCHAH 447 Sinorhizobium m...
P21880       368 QAKEEGLDIVAAKFPFAANGRALSLNETDGFMKLITRKEDGLVIGAQIAGASASDMISELSLAIEGGMTAEDIAMTIHAH 447 Bacillus subtil...
WP_010897986 359 QARENYGHVRIGEYPFAANGKALIVNETIGKVKVVVEPEYEAIVGLTIVGPHATELIAQGTLMVHNELTLDSLESFIAAH 438 Bacillus halodu...
WP_010896398 370 QAQEQGHRVKTARFPFQANGLALVASKPDGFAEVIVDEESHLLLGFHIVGADASNLIGEGVLALELGARVEDVALTVHPH 449 Bacillus halodu...
AAK39968     398 KCKELNMNFKSVSFPFAANSRSRTIDDYDGLIKLIVEKDTNRILGSQIIGNNASDLILPLSIYVANNGSSKSLSKIIYAH 477 malaria parasit...
WP_000292284 362 QAREK-YDVAIGKFNFAANGRAIASDAAQGFVKVIADKKYGEILGVHIIGPAAAELINEASSIIEMEITVEEMLKTIHGH 440 Streptococcus p...
WP_004083198 351 DVNPE--EVVISKFPVSANGRARTMLENIGFAKVIADKKDGTVLGMSIVSPSATDMIMEGVIAVKFRMKAEDLEKAIHPH 428 Thermotoga mari...
BAB04498     361 EAKEKGYSYKVVKVDLRANGKAMALGETTGFVKMIADPNYGEILGVTMVGPHVTEMIGEPAAFIHLEGTVDELKAMIHPH 440 Bacillus halodu...
AAA21748     475 QAKEKGIDYKVGKFQLAANGKSLIMNETGGVIKIITDKKYEEILGVHILGPRATDLITEAALALRLEATLEEIITTVHAH 554 Clostridium magnum
CAC47627     368 ELKAAGVAYKIGKFPFTANGRARAMLQTDGFVKILADKETDRVLGGHIIGFGAGEMIHEIAVLMEFGGSSEDLGRTCHAH 447 Sinorhizobium m...
P21880       368 QAKEEGLDIVAAKFPFAANGRALSLNETDGFMKLITRKEDGLVIGAQIAGASASDMISELSLAIEGGMTAEDIAMTIHAH 447 Bacillus subtil...
WP_010897986 359 QARENYGHVRIGEYPFAANGKALIVNETIGKVKVVVEPEYEAIVGLTIVGPHATELIAQGTLMVHNELTLDSLESFIAAH 438 Bacillus halodu...
WP_010896398 370 QAQEQGHRVKTARFPFQANGLALVASKPDGFAEVIVDEESHLLLGFHIVGADASNLIGEGVLALELGARVEDVALTVHPH 449 Bacillus halodu...
AAK39968     398 KCKELNMNFKSVSFPFAANSRSRTIDDYDGLIKLIVEKDTNRILGSQIIGNNASDLILPLSIYVANNGSSKSLSKIIYAH 477 malaria parasit...
WP_000292284 362 QAREK-YDVAIGKFNFAANGRAIASDAAQGFVKVIADKKYGEILGVHIIGPAAAELINEASSIIEMEITVEEMLKTIHGH 440 Streptococcus p...
WP_004083198 351 DVNPE--EVVISKFPVSANGRARTMLENIGFAKVIADKKDGTVLGMSIVSPSATDMIMEGVIAVKFRMKAEDLEKAIHPH 428 Thermotoga mari...
3URH_A       471 PTXSEAVKEAALSTFFKPIH 490 Sinorhizobium meliloti 1021
BAB04498     441 PTVSEALYEAAASWLGQGVH 460 Bacillus halodurans C-125
AAA21748     555 PTVGEAMKEAALAVNNQAIH 574 Clostridium magnum
CAC47627     448 PTMSEAVKEAALSTFFKPIH 467 Sinorhizobium meliloti 1021
P21880       448 PTLGEITMEAAEVAIGSPIH 467 Bacillus subtilis subsp. subtilis str. 168
WP_010897986 439 PTVSEAVHEAVLQALGQAVH 458 Bacillus halodurans
WP_010896398 450 PTFSEGWLGAAEAALGHAIH 469 Bacillus halodurans
AAK39968     478 PTFSEVIKEVALQSFDKPIH 497 malaria parasite P. falciparum
WP_000292284 441 PTYSEVMYEAFADVLGMAIH 460 Streptococcus pneumoniae
WP_004083198 429 PTLTETILGALEGVSGKPIH 448 Thermotoga maritima
BAB04498     441 PTVSEALYEAAASWLGQGVH 460 Bacillus halodurans C-125
AAA21748     555 PTVGEAMKEAALAVNNQAIH 574 Clostridium magnum
CAC47627     448 PTMSEAVKEAALSTFFKPIH 467 Sinorhizobium meliloti 1021
P21880       448 PTLGEITMEAAEVAIGSPIH 467 Bacillus subtilis subsp. subtilis str. 168
WP_010897986 439 PTVSEAVHEAVLQALGQAVH 458 Bacillus halodurans
WP_010896398 450 PTFSEGWLGAAEAALGHAIH 469 Bacillus halodurans
AAK39968     478 PTFSEVIKEVALQSFDKPIH 497 malaria parasite P. falciparum
WP_000292284 441 PTYSEVMYEAFADVLGMAIH 460 Streptococcus pneumoniae
WP_004083198 429 PTLTETILGALEGVSGKPIH 448 Thermotoga maritima
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap