1Y8B


Conserved Protein Domain Family
malate_syn_G

?
TIGR01345: malate_syn_G 
Click on image for an interactive view with Cn3D
malate synthase G
This model describes the G isozyme of malate synthase. Isocitrate synthase and malate synthase form the glyoxylate shunt, which generates additional TCA cycle intermediates. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 130412
View PSSM: TIGR01345
Aligned: 4 rows
Threshold Bit Score: 1400.81
Threshold Setting Gi: 499324552
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Y8B_A         3 QTITQSRLRIDANFKRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPvKDKAAYK 82 
WP_000084131   3 QTITQSRLRIDANFKRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPvKDKAAYK 82  Escherichia coli
WP_011015044  21 ERVDAGGMQVAKVLYDFVTEAVLPRVGVDAEKFWSGFAAIARDLTPRNRELLARRDELQMLIDDYHRNNSGT-IDQEAYE 99  Corynebacterium...
WP_010898290   3 TYEHVGNLQVATKLITFIEQRALPGTGIKKDDFWSGVQQIITELMPENKMLLAKREEIQATIDAWHQKNKGP-IDFSAYH 81  Bacillus halodu...
1Y8B_A        83 SFLRELGYLVPQPERVTVETTGIDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSG--YDP 160
WP_000084131  83 SFLRELGYLVPQPERVTVETTGIDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSG--YDP 160 Escherichia coli
WP_011015044 100 DFLKEIGYLVEEPEAAEIRTQNVDTEISSTAGPQLVVPILNARFALNAANARWGSLYDALYGTNAIPETDGAEKGkeYNP 179 Corynebacterium...
WP_010898290  82 SFLEEIGYLEPIPEHVTITTENVDDEIAAQAGPQLVVPVNNARYAINAANARWGSLYDALYGSNVISEEDGCEKTgtYNP 161 Bacillus halodu...
1Y8B_A       161 QRGEQVIAWVRRFLDESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIEL 240
WP_000084131 161 QRGEQVIAWVRRFLDESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIEL 240 Escherichia coli
WP_011015044 180 VRGQKVIEWGREFLDSVVPLDGASHADVEKYNITDGKLAAHIG-DSVYRLKNRESYRGFTGNFLDPEAILLETNGLHIEL 258 Corynebacterium...
WP_010898290 162 KRGTKVIQFAKDFLDHTFPLTSGSHHEAINYAIMDKQLVVTLESGKMTRLKDETQFVGYQGSQGDPSVILLLHHGLHVEI 241 Bacillus halodu...
1Y8B_A       241 QIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQEKMEKNGRQIVRKLNDDRHYT 320
WP_000084131 241 QIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQEKMEKNGRQIVRKLNDDRHYT 320 Escherichia coli
WP_011015044 259 QIDPVHPIGKADKTGLKDIVLESAITTIMDFEDSVAAVDAEDKTLGYSNWFGLNTGELKEEMSKNGRIFTRELNKDRVYI 338 Corynebacterium...
WP_010898290 242 QIDARHPIGKSDRAKVKDIVLESALTTIMDCEDSVAAVDAEDKVAVYQNWLGLMKGTLEATFTKEGKTKKRKLNEDRSYT 321 Bacillus halodu...
1Y8B_A       321 AADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEGILDGVMTGAIALYDLKVQ---KNSRTGSVYIVKPKMHGPQ 397
WP_000084131 321 AADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEGILDGVMTGAIALYDLKVQ---KNSRTGSVYIVKPKMHGPQ 397 Escherichia coli
WP_011015044 339 GRNGTELVLHGRSLLFVRNVGHLMQNPSILID-GEEIFEGIMDAVLTTVCAIPGIAPQnkmRNSRKGSIYIVKPKQHGPE 417 Corynebacterium...
WP_010898290 322 APNGETFSLPGRSLMFVRNVGHLMTTPVIRTQSGEEVPEGILDGIVTSLIAKHDLLQNgtfRNSKKGSVYIVKPKMHGSE 401 Bacillus halodu...
1Y8B_A       398 EVAFANKLFTRIETMLGMAPNTLKMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMK 477
WP_000084131 398 EVAFANKLFTRIETMLGMAPNTLKMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMK 477 Escherichia coli
WP_011015044 418 EVAFTNELFGRVEDLLDLPRHTLKVGVMDEERRTSVNLDASIMEVADRLAFINTGFLDRTGDEIHTSMEAGAMVRKADMQ 497 Corynebacterium...
WP_010898290 402 EVAFANRLFNRIEDILGLERHTLKIGVMDEERRTSLNLKACIEKVKERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK 481 Bacillus halodu...
1Y8B_A       478 STPWIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTAATLHALHYHQTNVQSVQ 557
WP_000084131 478 STPWIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTAATLHALHYHQTNVQSVQ 557 Escherichia coli
WP_011015044 498 TAPWKQAYENNNVDAGIQRGLPGKAQIGKGMWAMTELMAEMLEKKIGQPREGANTAWVPSPTGATLHATHYHLVDVFKVQ 577 Corynebacterium...
WP_010898290 482 SSSWLSAYERSNVAAGLTCGFQGRAQIGKGMWAMPDLMNEMMEQKGTQLEAGANTAWVPSPTAATLHAIHYHRHHVPAIQ 561 Bacillus halodu...
1Y8B_A       558 ANIAQTeFNAEfeplLDDLLTIPVAENANWSAQEIQQELDNNVQGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRI 637
WP_000084131 558 ANIAQTeFNAEfeplLDDLLTIPVAENANWSAQEIQQELDNNVQGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRI 637 Escherichia coli
WP_011015044 578 DELRAAgRRDS----LRNILTIPTAPNTNWSEEEKKEEMDNNCQSILGYVVRWVEHGVGCSKVPDIHDIDLMEDRATLRI 653 Corynebacterium...
WP_010898290 562 KTLADD-QTCY----RKEILEIPLAGSTDWTNEDIQAELNNNAQGILGYVVRWVEQGIGCSKVPDIHNTALMEDRATLRI 636 Bacillus halodu...
1Y8B_A       638 SSQHIANWLRHGILTKEQVQASLENMAKVVDQQNAGDPAYRPMAGNFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRL 717
WP_000084131 638 SSQHIANWLRHGILTKEQVQASLENMAKVVDQQNAGDPAYRPMAGNFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRL 717 Escherichia coli
WP_011015044 654 SSQMLANWIRHDVVSKEQVLESLERMAVVVDKQNAGDEAYRDMAPNYDASLAFQAAKDLIFEGTKSPSGYTEPILHARRR 733 Corynebacterium...
WP_010898290 637 SSQHMANWLRHGIVSKEQVIRTMERMAKVVDEQNAGDPAYRPMADNLEQSVAFQAALELVLKGTEQPSGYTEPILHRRRL 716 Bacillus halodu...
1Y8B_A       718 REKESH 723
WP_000084131 718 REKESH 723 Escherichia coli
WP_011015044 734 EFKAKN 739 Corynebacterium glutamicum
WP_010898290 717 EFKQKI 722 Bacillus halodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap