Conserved Protein Domain Family
acon_putative

?
TIGR01342: acon_putative 
aconitate hydratase, putative, Aquifex type
This model represents a small family of proteins homologous (and likely functionally equivalent to) aconitase 1. Members are found, so far in the anaerobe Clostridium acetobutylicum, in the microaerophilic, early-branching bacterium Aquifex aeolicus, and in the halophilic archaeon Halobacterium sp. NRC-1. No member is experimentally characterized. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 130409
View PSSM: TIGR01342
Aligned: 2 rows
Threshold Bit Score: 1231.77
Threshold Setting Gi: 499206382
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010881159   5 TVAWKIIKNHLVSGKMEPGEEIAIKIDQTLTQDATGTMCYLEFEAMGVPEVKTELSVSYIDHNMLQTDFRNADDHKYLMS 84  Aquifex aeolicus
WP_010903922   4 TLTEKILDDHLVEGDLQPGEEIGIEIDQTLSQDTTGTMVWLQFEALEMDEVQTELAAQYCDHQTYQFDFKNTDDHRFLRS 83  Halobacterium s...
WP_010881159  85 VAKKFGIWLSKPGNGICHQVHLERFAKPGKTLLGSDSHTPTAGGMGMLAIGAGGLDVAAAMAGEPFYLKMPKIVGVHLKG 164 Aquifex aeolicus
WP_010903922  84 AAGTYGAYFSRPGNGICHNVHKENFAAPGKTLLGSDSHTPTPGGLGQLAIGAGGIDIAVAMGGGAYYVEMPEVVNVRLEG 163 Halobacterium s...
WP_010881159 165 KMPEWVTAKDIILELLRRLTVKGGLGKIFEYFGEGVKELSVPERATITNMGAELGATTSIFPSDEITRAYLRAQGREEDW 244 Aquifex aeolicus
WP_010903922 164 ELPEWATAKDVILELLRRLSVKGGVGKVLEYTGPGVESLSVPERTTITNMGTELGATSSIFPTDDRTEDWLARFDREDEF 243 Halobacterium s...
WP_010881159 245 VELLPDPDAEYDEVIEINLSELEPLIAQPHSPDNVVPVREIEGIKVDQVVIGSCTNSSFVDLTRAAKLLEGRRVHPDVVF 324 Aquifex aeolicus
WP_010903922 244 VDLQADADAEYADEIVVDLSDLEPLIAEPSMPDNVVPVREVAGQEVEQVMVGSCTNGAYEDVLPAAKMLEGREVSKHTEM 323 Halobacterium s...
WP_010881159 325 AVAPGSKQALELITQNGALLNFLKAGARILESACGPCIGMGFAPPTNGVSVRSFNRNFKGRAGTPDAKVYLASPETCVAA 404 Aquifex aeolicus
WP_010903922 324 IVAPGSKQASEMLAREGWTAEMMAAGVNFSEATCGACIGIGHVPASDSVSLRTFNRNFEGRSGIEDDSVYLCSPEVATAS 403 Halobacterium s...
WP_010881159 405 AIAGEIIDPRKLAEREG-VKWIRVEMPEKFPYG-DEAFIPPLPKEEREKVEIYRGPNIKPLPEFEPLPETIEGEVALIVE 482 Aquifex aeolicus
WP_010903922 404 AIAGEIVDPRDLSDDLGdLEAPGFEMGTSYSGGyGAGDTDIITPEESIDDDLIKGPNISSVPVKDPLGADVRGETLLKMQ 483 Halobacterium s...
WP_010881159 483 DNITTDHIMPAGAKILPLRSNIYAISEYVYHYVDPEFVPRMKKLKEkgkaGIIIGGENYGQGSSREHAALAPRFLGVRAV 562 Aquifex aeolicus
WP_010903922 484 DNITTDHIIPATSDILKFRSNIERLSEFTLSRIDDTFAERAKAADS----GVLVAGENYGQGSSREHAAMCPMFLGVESV 559 Halobacterium s...
WP_010881159 563 IAKSFARIHHANLVNFGVVPLEFKnKEDYDKFSLGDEIEIPN-LIERLKKGEDILVINKTTGEEILCTYNLTPVQKEILI 641 Aquifex aeolicus
WP_010903922 560 LAQSFARIHKANLFNFGILPLNID-EETYARIEQGDDVEVVDdVAAAVADGQEEFTVRVNDDWEATATLDASERERRTLA 638 Halobacterium s...
WP_010881159 642 AGGRLNYIKNKHRKEVSA 659 Aquifex aeolicus
WP_010903922 639 AGGKLSLTKQRHSEGSGA 656 Halobacterium salinarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap