2BV8


Conserved Protein Domain Family
phycocy_alpha

?
TIGR01338: phycocy_alpha 
Click on image for an interactive view with Cn3D
phycocyanin, alpha subunit
This model describes the phycocyanin alpha subunit. Other, homologous phyobiliproteins of the phycobilisome include phycocyanin alpha chain and the allophycocyanin and phycoerythrin alpha and beta chains. This model excludes the closely related phycoerythrocyanin alpha subunit. [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130405
View PSSM: TIGR01338
Aligned: 4 rows
Threshold Bit Score: 265.272
Threshold Setting Gi: 43386
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BV8_A     2 KTPITEAIASADSQGRFLSNGELQSINGRYQRATASLEAARSLTSNAERLISGAAQSVYSKFPYTtQMQGPNYAADATGK 81  Gracilaria chilensis
CAA30065   2 KTPLTEAVAAAHSQGAFLSSTEIQTAFGRFRQASASLAAAKALTEKASSLASGAANAVYSKFPYT-SQNGPNFASTQTGK 80  Tolypothrix sp. PCC...
P05730     2 KTPITEAIATADNQGRFLSNSELHASFGRFQRAASALEAARSLTSNSQKLIDGAAAAVYQKFPYTtQTFGPQYASTAEGK 81  Cyanophora paradoxa
P28557     2 KTPITEAIACADSQGRFLSNGELQSINGRYQRATASLEAAKSLNNNAQRLITGAAQAVYTKFPFVtQMPGPTYASRAIGK 81  Aglaothamnion negle...
2BV8_A    82 AKCARDIGYYLRMVTYcLVVGATGPMDEYLIAGLSEINRSFELSPSWYIEALEYIKDSHALSGQAANEANTYLDYAINAL 161 Gracilaria chilensis
CAA30065  81 DKCVRDIGYYLRMVTY-CLVGGTGPLDDYLIGGIAEINRTFDLSPSWYVEALKYIKANHGLSGDPAVEANSYIDYAINAL 159 Tolypothrix sp. PCC...
P05730    82 AKCTRDIGYYLRIVTYaLVAGGTGPLDEYLVAGLEEMNRAFDLSPSWYVEALKYIKANHGLSGQAATEANGYFDYVINAL 161 Cyanophora paradoxa
P28557    82 AKCARDIGYYLRMTTYcLVVGATGPMDEYLVAGLEEINRSFELSPSWYIEALEYIKNTHGLSGQAANEANTYLDYAINIL 161 Aglaothamnion negle...
2BV8_A   162 S 162 Gracilaria chilensis
CAA30065 160 S 160 Tolypothrix sp. PCC 7601
P05730   162 S 162 Cyanophora paradoxa
P28557   162 S 162 Aglaothamnion neglectum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap