1JB0


Conserved Protein Domain Family
psaA

?
TIGR01335: psaA 
Click on image for an interactive view with Cn3D
photosystem I core protein PsaA
The core proteins of photosystem I are PsaA and PsaB, homologous integral membrane proteins that form a heterodimer. The heterodimer binds the electron-donating chlorophyll dimer P700, as well as chlorophyll, phylloquinone, and 4FE-4S electron acceptors. This model describes PsaA only. [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130402
View PSSM: TIGR01335
Aligned: 4 rows
Threshold Bit Score: 1472.88
Threshold Setting Gi: 6685788
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JB0_A   1 MTISPPEREPK-VRVVVDNDPVPTSFEKWAKPGHFDRTLARGPQTTTWIWNLHALAHDFDTHTSDLEDISRKIFSAHFGH 79  Synechococcus elongatus
O52474   1 MTISPPEREEKkARVIVDNDPVPTSFELWAKPGHFDRTLARGPKTTTWIWNLHALAHDFDTHTSDLEDISRKIFAAHFGH 80  Mastigocladus laminosus
P56766   1 MIIRSPEPe---VKILVDRDPIKTSFEEWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQ 77  thale cress
Q9TLQ5   1 MNQILKEKEQKtAKILVDRNPVPTSFEKWGVPGHFSRSLAKGPKTTTWIWNLHADVHDFDSHTSSLEDISRKIFSAHFGQ 80  Cyanidium caldarium
1JB0_A  80 LAVVFIWLSGMYFHGAKFSNYEAWLADPTGIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFQLWRASGITNEFQLY 159 Synechococcus elongatus
O52474  81 LAVVTLWLSGMIFHGARFSNYEAWLSDPLHVKPSAQVVWPIVGQDILNGDVGGGFHGIQITSGLFQIWRGWGITNSFQLY 160 Mastigocladus laminosus
P56766  78 LSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLY 157 thale cress
Q9TLQ5  81 LSLIFIWLSGMYFHGARFSNYTIWLSNPSLIKPSAQIVWPIVGQEILNADLGGGSQGIQITSGFFHLWRASGITNELELY 160 Cyanidium caldarium
1JB0_A 160 CTAIGGLVMAGLMLFAGWFHYHKRAPKLEWFQNVESMLNHHLAGLLGLGSLAWAGHQIHVSLPINKLLDAGVAAKDIPLP 239 Synechococcus elongatus
O52474 161 VTAIGGLVLAGLFLFAGWFHYHKRAPKLEWFQNVESMLNHHLAVLLGCGSLGWAGHLIHVSAPTNKLLDAGVSVKDIPLP 240 Mastigocladus laminosus
P56766 158 CTAIGALVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQFLNAGVDPKEIPLP 237 thale cress
Q9TLQ5 161 VTALGGLFMAGLMAFGGWFHYHKAAPKLEWFQNVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINKLLDAGVDPKTIPLP 240 Cyanidium caldarium
1JB0_A 240 HEFILNPSLMAELYPkvdwGFFSGVIPFFTFNWAAYSDFLTFNGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNW 319 Synechococcus elongatus
O52474 241 HEFILNKGLLTELYP----GFASGITPFFTLNWGQYADFLTFKGGLNPVTGGLWLTDISHHHLAIAVLFIIAGHMYRTNW 316 Mastigocladus laminosus
P56766 238 HEFILNRDLLAQLYP----SFAEGATPFFTLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRTNW 313 thale cress
Q9TLQ5 241 HEFILNRELMSQLYP----SFEKGLWPFFSLNWGAYSDFLTFRGGLNPITGSLWMSDIAHHHLAISVLFIVAGHMYRTNW 316 Cyanidium caldarium
1JB0_A 320 GIGHSLKEILEAHKGPFTGAGHKGLYEVLTTSWHAQLAINLAMMGSLSIIVAQHMYAMPPYPYLATDYPTQLSLFTHHMW 399 Synechococcus elongatus
O52474 317 GIGHSIKEILENHKGPFTGEGHKGLYENMTTSWHAQLATNLAFLGSLTIIVAHHMYAMPPYPYLATDYATQLCIFTHHMW 396 Mastigocladus laminosus
P56766 314 GIGHGIKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSLNLAMLGSLTIIVAHHMYSMPPYPYLATDYATQLSLFTHHMW 393 thale cress
Q9TLQ5 317 GIGHSIKEILDAHRGPLTGSGHRGLYEALTTSWHANLAINLALFGSLSIIVAHHMYAMPPYPYISIDYPTQLSLFTHHTW 396 Cyanidium caldarium
1JB0_A 400 IGGFLVVGGAAHGAIFMVRDYDPAMNQNNVLDRVLRHRDAIISHLNWVCIFLGFHSFGLYVHNDTMRAFGRPQDMFSDTG 479 Synechococcus elongatus
O52474 397 IGGFLIVGGAAHATIFMVRDYDPVVNQNNVLDRVIRHRDAIISHLNWVCIFLGFHSFGLYVHNDTMRALGRPQDMFSDTA 476 Mastigocladus laminosus
P56766 394 IGGFLIVGAAAHAAIFMVRDYDPTNRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTA 473 thale cress
Q9TLQ5 397 IGGFCIVGASAHGAIFMIRDYVPSQHYNNVLDRLIRHRDALISHLNWVCIFLGTHSFGLYIHNDTMRALGRSQDMFSDTA 476 Cyanidium caldarium
1JB0_A 480 IQLQPVFAQWVQNLHTLAPGGTAPNAAATASVAFGG-DVVAVGGKVAMMPIVLGTADFMVHHIHAFTIHVTVLILLKGVL 558 Synechococcus elongatus
O52474 477 IQLQPVFAQWVQNIHTLAPGSTAPNALEPASYAFGG-GIVAVGGKVAMMPIALGTADFLVHHIHAFTIHVTVLILLKGFL 555 Mastigocladus laminosus
P56766 474 IQLQPVFAQWIQNTHALAPGVTAPGETASTSLTWGGgELVAVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVL 553 thale cress
Q9TLQ5 477 IQLQPIFAQWIQSLHTLAPANTAPNALATTSYVFGG-EVVAVANKIAMMPMKLGTADFMVHHIHAFTIHVTLLILLKGVL 555 Cyanidium caldarium
1JB0_A 559 FARSSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNCISVVIFHFSWKMQSDVWGTVAPDGTVSHITGGN 638 Synechococcus elongatus
O52474 556 FARNSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSISIVIFHFSWKMQSDVWGTVDAAGNVTHITGGN 635 Mastigocladus laminosus
P56766 554 FARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNAISVVIFHFSWKMQSDVWGSISDQGVVTHITGGN 633 thale cress
Q9TLQ5 556 FARNSRLIPDKANLGFRFPCDGPGRGGTCQVSSWDHVFLGLFWMYNCISVVIFHFSWKMQSDVWGTVSQNSLVSHVVGGN 635 Cyanidium caldarium
1JB0_A 639 FAQSAITINGWLRDFLWAQASQVIGSYGSALSAYGLLFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQ 718 Synechococcus elongatus
O52474 636 WAQSALTINGWLRDFLWAQSVQVINSYGSALSAYGLMFLGAHFIWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQ 715 Mastigocladus laminosus
P56766 634 FAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQ 713 thale cress
Q9TLQ5 636 FSQSAITINGWLRDFLWAQASQVIQSYGSSISAYGLMFLAAHFIWAFSLMFLFSGRGYWQELIESIVWAHSKLKIAPTIQ 715 Cyanidium caldarium
1JB0_A 719 PRALSIIQGRAVGVAHYLLGGIATTWAFFLARIISVG 755 Synechococcus elongatus
O52474 716 PRALSIIQGRAVGVAHYLLGGIATTWAFFHAHILSLG 752 Mastigocladus laminosus
P56766 714 PRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG 750 thale cress
Q9TLQ5 716 PRALSITQGRAVGAAHYLLGGIATTWAFFLSRAISIG 752 Cyanidium caldarium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap