Conserved Protein Domain Family
modD

?
TIGR01334: modD 
putative molybdenum utilization protein ModD
The gene modD for a member of this family is found with molybdenum transport genes modABC in Rhodobacter capsulatus. However, disruption of modD causes only a 4-fold (rather than 500-fold for modA, modB, modC) change in the external molybdenum concentration required to suppress an alternative nitrogenase. ModD proteins are highly similar to nicotinate-nucleotide pyrophosphorylase (also called quinolinate phosphoribosyltransferase). The function unknown. [Unknown function, General]
Statistics
?
PSSM-Id: 130401
View PSSM: TIGR01334
Aligned: 3 rows
Threshold Bit Score: 490.183
Threshold Setting Gi: 6478238
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAF13762      12 LPISTGLIENLWMEDAGYGDLTTRSLGIQDHPAHITFTARDEQIASSVEEAAALLKQLGASIDYAIPSGSRALSGTLLLE 91  Zymomonas mobil...
WP_005757236   2 LYFSDNELDDFLLEDIYRGDLTTHALGLESIPAEICFKRKNAGIVAGISIAEKLLRKLDIHPQVYVKEGEFVEAGSLLLS 81  Pasteurella mul...
WP_000576838   2 IFLSQAQIDALLLEDIQGGDLTTRALNIGHQHGYIEFFLRQGGCVSGVSVACKMLTTLGLTIDDAVSDGSQANAGQRLIR 81  Enterobacteriaceae
AAF13762      92 AKASAGQLHLGWKSAQSLMEWSAGIATMTHKMVTLAKKISPMAVVGCTRKAPPLTRPLAVKAVLAGGGVMHRINLSETLL 171 Zymomonas mobil...
WP_005757236  82 AKGSADKLHQAWKVVQLVLEWSCGVAQYTAEMISNAKAINPAAVVACTRKSIPNTRKLATNAVLAAGGHIHRQGLSETLL 161 Pasteurella mul...
WP_000576838  82 AQGNAAALHQGWKAIQNVLEWSCGVSDYLDQMLALLRERYPDGNIACTRKAIPGTRLLASQAILAAGGLIHRAGCAETIL 161 Enterobacteriaceae
AAF13762     172 VFAEHLTFMN--FDIGKAIGRLKQTAPERKITVEVETIEQALTVAQFSPDILQLEKFTPQQLHHLHERLKFFDHIPSLAA 249 Zymomonas mobil...
WP_005757236 162 VFTNHRNLLSdpEDWQGIVTRLKQQAPENKITLEADNLVQFEQMLTADPDIIQLDKFTLEQVKQALHLLALANKNITLSV 241 Pasteurella mul...
WP_000576838 162 LFANHRHFLHdnQDWSGAINQLRRHAPEKKIVVEADTPKEAIAALRAQPDVLQLDKFSPQQATEIAQIAPSLAPHCTLAL 241 Enterobacteriaceae
AAF13762     250 AGGINPENIADYIEAGADIIVTSAPYYAKPCDVQVKL 286 Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
WP_005757236 242 AGGVNKHNVAEYAKLGIQLFITSAPYYAAPEDIKVII 278 Pasteurella multocida
WP_000576838 242 TGGINLTTLKNYLDCGIRLFITSAPYYAAPADIKVSL 278 Enterobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap