Conserved Protein Domain Family
cyt_b559_alpha

?
TIGR01332: cyt_b559_alpha 
cytochrome b559, alpha subunit
This model describes the alpha subunit of cytochrome b559, about 83 residues in length. The N-terminal half is homologous to the ~ 40-residue beta subunit. Cytochrome b559 is associated with photosystem II. Sequences scoring between trusted and noise cutoffs are fragments. [Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130399
View PSSM: TIGR01332
Aligned: 3 rows
Threshold Bit Score: 162.372
Threshold Setting Gi: 499174134
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P56309        2 SGATGERPFSDILTSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTEDRQETPLITDRFNALEQVKKFSE 81  Chlorella vulgaris
O78466        3 GGSTGERPFSDIITSIRYWIIHSITIPALFVAGWLFVSTGLAYDIFGTPRPNEYFTQERQQVPLVNDRFSAKQELEDLTK 82  Guillardia theta
WP_010871721  2 SGTTGERPFSDIVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDAFGTPRPDEYFTQTRQELPILQERYDINQEIQEFNQ 81  Synechocystis sp...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap