Conserved Protein Domain Family
bisphos_cysQ

?
TIGR01331: bisphos_cysQ 
3'(2'),5'-bisphosphate nucleotidase, bacterial
Sulfate is incorporated into 3-phosphoadenylylsulfate, PAPS, for utilization in pathways such as methionine biosynthesis. Transfer of sulfate from PAPS to an acceptor leaves adenosine 3'-5'-bisphosphate, APS. This model describes a form found in bacteria of the enzyme 3'(2'),5'-bisphosphate nucleotidase, which removes the 3'-phosphate from APS to regenerate AMP and help drive the cycle. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 130398
View PSSM: TIGR01331
Aligned: 6 rows
Threshold Bit Score: 394.51
Threshold Setting Gi: 499217417
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P70714         8 LLQDVIEIAQQAGEHLRCFYQ--RSVTVRMKEDNTPVTEADLFVSQFLTEKLTALTPQIPILSEENCHIPLTERQTWRSY 85  Aggregatibacter...
WP_000106799  10 LLPDVINIARAAGQLILDIYQn-KSYEAFTKSDSTPVTSADLAAHKFLCEQLRELTPDIPILSEEEANIDLATRETWQRY 88  Vibrio cholerae
WP_010880167   1 MLEKVIKACKKAGEEILEVYS--KEFTVEEKEDRTPVTEADRRAHRIITEELKETR--IPVLSEEGKEIPFKERRKWKRF 76  Aquifex aeolicus
WP_000886884   1 MLDQVCQLARNAGDAIMQVYDgaKPMDVVSKADNSPVTAADIAAHTVIMDGLRTLTPDIPVLSEED-PPGWEVRQHWQRY 79  Escherichia coli
WP_010921298  14 WGRTLAKITEEAAVVILPFWR--TELAVAQKADESPVTEADRAGERLILERLAALYPAIPVISEEDASEFGTPESVGPRF 91  Caulobacter vib...
WP_010914957  21 MLDILERLALAAGREVMRVFH--AGCAVDRKSDASPVTEADRESEKIILSGLRAAFPEIPCVAEEEAAAGIMPTDLGEAF 98  Mesorhizobium loti
P70714        86 WLIDPLDGTQQFINRTGQFSVLVSLVKDHQPVLGVIHAPMLGSTYYAMQGFGAYKHHDG---QHLKLAFHDIQADN-ALR 161 Aggregatibacter...
WP_000106799  89 WLVDPLDGTQEFIARSGDFATIIALVENNHPVMGVVYGPVSGVTYYAYAGKGAWKIPDMa--QSLKIQTHKHELPSsSIA 166 Vibrio cholerae
WP_010880167  77 WLVDPLDGTKEFIKKNGEFTVNVALVEEGEPVLGVVYAPALEVLYFAEKGNGAYREVKG-----KMEKLPIGNWSReNLR 151 Aquifex aeolicus
WP_000886884  80 WLVDPLDGTKEFIKRNGEFTVNIALIDHGKPILGVVYAPVMNVMYSAAEGKAWKEE-CG-----VRKQIQVR--DArPPL 151 Escherichia coli
WP_010921298  92 FLVDPVDGTKAFVRGDPNFTVNIGLIEHGVPVAGAVCAPATGEVWFTTADGAAKRAGPD----AAEAPIRVRPWPTgQAL 167 Caulobacter vib...
WP_010914957  99 FLIDPLDGTKEFVNRRTDFTVNIALVRHGVPEVGVVFAPCTGRFFSGRPGSAEALEIDDdyqIVGRRPISVRAAAS-PLA 177 Mesorhizobium loti
P70714       162 IAVGSAAAAEKVRSIL-NkNL----AYEFHICGSSGLKSTLVADGVCDCYIRLGCTGEWDTAASEILLAEMGGIIFDLNY 236 Aggregatibacter...
WP_000106799 167 IAISRRQDINKITRRLsS-AW----NYDLVPLGSAALKACLVAEGAVDCYLRLGPTGEWDTAATQCIVEEAGGRILSTQL 241 Vibrio cholerae
WP_010880167 152 VVASRSHMNEETKKFL-E-NLekkfGKLQFLSKGSSLKICMVAEGSADIYPRIAPTMEWDTGAGHAVAKEAGCELFVYEE 229 Aquifex aeolicus
WP_000886884 152 VVISRSHADAELKEYL-Q-QL----GEHQTTSIGSSLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHDWQG 225 Escherichia coli
WP_010921298 168 GLISHTMREEKATELA-A-EY----GFDLRTPMDSSIKMCRIAEGSADIYPRHGPTSEWDTAAGHAVLVAAGGAFTQPDG 241 Caulobacter vib...
WP_010914957 178 VVASRSHNTPETEAYI-R-DL----GAAEIVSVGSSLKFCLLASAEADVYPRFGRTMEWDTAAGDAVLRAAGGTTRTLDG 251 Mesorhizobium loti
P70714       237 QPLTYNKR-----E-SFVNPNFVMGI 256 Aggregatibacter actinomycetemcomitans
WP_000106799 242 SPLSYNER-----E-TLENPNFIVLG 261 Vibrio cholerae
WP_010880167 230 GKLREPLRyn--kE-DLRNPSFVCLS 252 Aquifex aeolicus
WP_000886884 226 KPLDYTPR-----E-SFLNPGFRVSI 245 Escherichia coli
WP_010921298 242 SPFLYGKA-----DqSFRNGWFVARG 262 Caulobacter vibrioides
WP_010914957 252 KPLAYGKRdqaddE-DFANPHFIASG 276 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap