1E5E


Conserved Protein Domain Family
met_gam_lyase

?
TIGR01328: met_gam_lyase 
Click on image for an interactive view with Cn3D
methionine gamma-lyase
This model describes a methionine gamma-lyase subset of a family of PLP-dependent trans-sulfuration enzymes. The member from the parasite Trichomonas vaginalis is described as catalyzing alpha gamma- and alpha-beta eliminations and gamma-replacement reactions on methionine, cysteine, and some derivatives. Likewise, the enzyme from Pseudomonas degrades cysteine as well as methionine. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130395
View PSSM: TIGR01328
Aligned: 4 rows
Threshold Bit Score: 695.481
Threshold Setting Gi: 499223464
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1E5E_A         5 RMTPATACIHAN-PQKDQFGAAIPPIYQTSTFVFDNCQQGGNRFAGQESGYIYTRLGNPTVSNLEGKIAFLEKTEACVAT 83  Trichomonas vag...
WP_010896972   4 DQHFETRAIHTGyKPNEHFDSLTPPIYQTSTFTFASMEQGGNRFAGEEAGYVYSRLGNPTVQILEQRIAELEGGEAALAF 83  Bacillus halodu...
CAA04124       5 RMTPATACIHAN-PQKDQFGAAIPPIYQTSTFVFDNCQQGGNRFAGQESGYIYTRLGNPTVSNLEGKIAFLEKTEACVAT 83  Trichomonas vag...
WP_010921004   5 QTGFSTRAIHAGyDPADEHGALTPPLHLTSTFAFESAEAGGEMFAGTREGHFYSRISNPTTDLLERRLASLEGAEAAVAT 84  Caulobacter vib...
1E5E_A        84 SSGMGAIAATVLTILKAGDHLISDECLYGCTHALFEHALTKFGIQVDFINTAIPGEVKKHMKPNTKIVYFETPANPTLKI 163 Trichomonas vag...
WP_010896972  84 GSGMAAVSAILVGLTKANDHILVSNGVYGCTFGLLTMLKEKYNIDATFSPMDSVEEILANIQDNTTCIYVETPINPTMQL 163 Bacillus halodu...
CAA04124      84 SSGMGAIAATVLTILKAGDHLISDECLYGCTHALFEHALTKFGIQVDFINTAIPGEVKKHMKPNTKIVYFETPANPTLKI 163 Trichomonas vag...
WP_010921004  85 ASGMGAITATLWSFLRAGDEVITDQTLYGCTFAFLRDGLTRFGVTVKQVDMTRPETLAAAISDQTRIVYFETPANPNMRL 164 Caulobacter vib...
1E5E_A       164 IDMERVCKDAHSQeG-VLVIADNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGLICGKADLLQQIRMVGIKDITG 242 Trichomonas vag...
WP_010896972 164 IDLELVVRVAKEK-G-IKVIVDNTFATPYLQQPIALGCDFVVHSATKYIGGHGDVVAGVLIGDKETIQLIRKTTQKDMGG 241 Bacillus halodu...
CAA04124     164 IDMERVCKDAHSQ-EgVLVIADNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGLICGKADLLQQIRMVGIKDITG 242 Trichomonas vag...
WP_010921004 165 VDIAAITRIAHAA-G-AKVVVDNTYATPCLTRPLALGADIVVHSATKYLGGHGDLVGGIAAGGIEDMARVRLCGVKDMTG 242 Caulobacter vib...
1E5E_A       243 sVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYPGFEDHEGHDIAKKQMRMYGSMITFILKSGFEG 322 Trichomonas vag...
WP_010896972 242 -VISPFDAWLLLRGLKTLAVRMDRHCENAEKLAEKLKEHPKVSTVLYPGDFEHPDHSIVAKQMKKGGGLLSFEIKGTEAD 320 Bacillus halodu...
CAA04124     243 sVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSHPAVEKVYYPGFEDHEGHDIAKKQMRMSGSMITFILKSGFEG 322 Trichomonas vag...
WP_010921004 243 aVMSPFTAFLVLRGLKTLSLRMARHSQSAQAVARWLEDHPAVEQVFYPGLQSFPQRDLAARQMAAGGGMMAFELKGGHAA 322 Caulobacter vib...
1E5E_A       323 AKKLLDNLKLITLAVSLGGCESLIQHPASMTHAVVPKEEREAAGITDGMIRLSVGIEDADELIADFKQGLDAL 395 Trichomonas vaginalis G3
WP_010896972 321 IAKVVNQLKLIRIAVSLGDAETLIQHPATMTHAVVPEKRRTQMGISKKLLRMSAGLEAWQDVWADLEQALNQL 393 Bacillus halodurans
CAA04124     323 AKKLLDNLKLITLAVSLGGCESLIQHPASMTHAVVPKEEREAAGITDGMIRLSVGIEDADELIADFKQGLDAL 395 Trichomonas vaginalis
WP_010921004 323 GVAMMNRLALIRRAVSLGDAETLIQHPASMTHSPYTPEERAAAGIGEGMVRLSVGLEDVADILADLAMALEPL 395 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap