Conserved Protein Domain Family
cysta_beta_ly_B

?
TIGR01324: cysta_beta_ly_B 
cystathionine beta-lyase, bacterial
This model represents cystathionine beta-lyase (alternate name: beta-cystathionase), one of several pyridoxal-dependent enzymes of cysteine, methionine, and homocysteine metabolism. This enzyme is involved in the biosynthesis of Met from Cys. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 130391
View PSSM: TIGR01324
Aligned: 3 rows
Threshold Bit Score: 641.927
Threshold Setting Gi: 499221760
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44527         9 TMFIHSGRQKRFSQGSVNPVLQRASSLLFDSiedkkHATQRRAKGELFYGRRGTLTHFALQDLMCEMEGGAGCYLYPCGT 88  Haemophilus inf...
WP_010915393   5 TRLAHSGNNPHDYFGFVNPPVVHASTVLYRN-----AAAMAGRSQKYTYGTRGTPTTDALAQAIDALEGSAGTIAVPSGL 79  Mesorhizobium loti
WP_010919300   5 TRLIHTGSEPARLGRTVNPPIQRGSTVLLP------DAASLYDDDQLTYGITGLSTPVALQNALAELEGATNVTLYPSGL 78  Caulobacter vib...
P44527        89 AAVTNSILSFVKTGDHVLMSGAAYEPTQYFCNIVLKKMQIDITYYDPLIG-EDIATLIQPNTKVLFLEAPSSITMEIPDI 167 Haemophilus inf...
WP_010915393  80 AAVTIPLLAFVSAGDHLLIVDSVYHPTRNFADTILKRLGVEVEYYDPHIG-AGIAALIKPNTKVVFTESPASNTFEVQDI 158 Mesorhizobium loti
WP_010919300  79 AAITGAMLAVLKAGDEVLVVDSAYKPTRRFCDRVLGRFGVTTRYYDPKLSpEALMGLVTSSTRLIVLEAPGSLTFEMQDI 158 Caulobacter vib...
P44527       168 PTIVKAARkvNPNIVIMIDNTWSAGVLFKALEHDIDISIQAGTKYLVGHSDIMIGTAVANARTWDQLR-EHSYLMGQMVD 246 Haemophilus inf...
WP_010915393 159 PAIAKVAH--TAGAIVMMDNTWATPLYFRPLDHGVDISIHAATKYPAGHSDVLLGTVSANESHWEQLY-ESFCTLGCCAG 235 Mesorhizobium loti
WP_010919300 159 PAIAAAAN--ARGVLTLIDNTWAAGLLFKPLAHGVTMSVQALTKYVGGHSDCFMGSVATCDDAVAKLLgDAMWDIGWSVS 236 Caulobacter vib...
P44527       247 ADSAYTTARGIRTLGVRLKQHQESSIKVAKWLSEQPEVKTVYHPALPSCPGHEFFLRDFSGSSGLFSFELtQRLTSEQVS 326 Haemophilus inf...
WP_010915393 236 PDDVYQVLRGLRTMGVRLEHHQRSALAIASWLEGQKGVARVLHPALPSHPDHDLWKRDFCGSSGIFSIVL-AGGGQKEQH 314 Mesorhizobium loti
WP_010919300 237 SDDAYTMLRGLRTLATRLPRHAENGLAIARWLQERPEVARVLHPALPGDAGHAIWKRDFTGACGLFGVVL-KPCSQKAVH 315 Caulobacter vib...
P44527       327 KFMDHFQLFAMAYSWGGFESLILCNQpeeIAHiRPNIKRNLTGSLIRVHIGFENVDELIADLKAGFERI 395 Haemophilus influenzae Rd ...
WP_010915393 315 AFLDALRIFGLGYSWGGYESLAVPVW---LGD-RVVAKGPYEGPLIRLQIGLEDVDDLKADILGGLAAA 379 Mesorhizobium loti
WP_010919300 316 AFLDSLKLFGLGFSWGGYESLALNCDp-qLG--ARSIPVDLEGPLLRFHIGLEGIEDLKADLRRGFEAL 381 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap