1RCS


Conserved Protein Domain Family
TrpR

?
TIGR01321: TrpR 
Click on image for an interactive view with Cn3D
trp operon repressor, proteobacterial
This model represents TrpR, the repressor of the trp operon. It is found so far only in the gamma subdivision of the proteobacteria and in Chlamydia trachomatis. All members belong to species capable of tryptophan biosynthesis. [Amino acid biosynthesis, Aromatic amino acid family, Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 130388
View PSSM: TIGR01321
Aligned: 4 rows
Threshold Bit Score: 124.159
Threshold Setting Gi: 499196846
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RCS_A         8 MAEQR-HQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSL 86  Escherichia coli
P44889         1 MYISRnLEQWNAFLQMLKIAFEENKAQEFLTLLLTADERDAVGLRLQIVSQLIDKNMPQREIQQNLNTSAATITRGSNMI 80  Haemophilus inf...
O84171         1 MKNQE-ESGWQAFLTLCSKMQKEKFLQDLFSLFLSFSERKDVASRYHIIRALLEGELTQREIAEKYGVSIAQITRGSNAL 79  Chlamydia trach...
WP_010894386   1 MS--R-EQAFEMLIKILCKTDSTDDMKLILECILTRSEMEDLIDRIRIYNELLNTNNSQREVASKLGVSITKITRGAANL 77  Xylella fastidiosa
1RCS_A        87 KAAPVELRQWLEEVL 101 Escherichia coli
P44889        81 KTMDPDFMQWMKQHL 95  Haemophilus influenzae Rd KW20
O84171        80 KGLDPQFKEFLQKEI 94  Chlamydia trachomatis D/UW-3/CX
WP_010894386  78 Q--DNNIKDFLRKKI 90  Xylella fastidiosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap