Conserved Protein Domain Family
mal_quin_oxido

?
TIGR01320: mal_quin_oxido 
malate:quinone-oxidoreductase
This membrane-associated enzyme is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle. The reduction of a quinone rather than NAD+ makes the reaction essentially irreversible in the direction of malate oxidation to oxaloacetate. Both forms of malate dehydrogenase are active in E. coli; disruption of this form causes less phenotypic change. In some bacteria, this form is the only or the more important malate dehydrogenase. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 130387
View PSSM: TIGR01320
Aligned: 4 rows
Threshold Bit Score: 913.448
Threshold Setting Gi: 553798855
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O05807         7 TDVVLIGAGIMSATLGVLLRRLEPNWSITLIERLDAVAAESSGPWNNAGTGHSALCEMNYTPEMPdGSIDITKAVRVNEQ 86  Mycobacterium t...
CAA12237      15 ADVVLIGAGIMSSTLGAMLRQLEPSWTQIVFERLDGPAQESSSPWNNAGTGHSALCELNYTPEVK-GKVEIAKAVGINEK 93  Corynebacterium...
WP_002246529   5 TDVVLVGGGIMSATLGVLLKELEPSWEITLIERLEDVALESSNAWNNAGTGHSALCELNYAPLGAnGIIDPARALNIAEQ 84  Neisseria menin...
WP_023129351   9 VDMLLVGAGIMSATLAVLLKELDPNLKMEVVELQESGAIESSNPWNNAGTGHAGLCELNYTPQSAdGSIDIKKAVGINTM 88  Pseudomonas aer...
O05807        87 FQVTRQFWAYAAENGILTDVRSFLNPVPHVSFVHGSRGVEYLRRRQKALAGNPLFAGTEFIESPDEFARRLPFMAAKRAF 166 Mycobacterium t...
CAA12237      94 FQVSRQFWSHLVEEGVLSDPKEFINPVPHVSFGQGADQVAYIKARYEALKDHPLFQGMTYADDEATFTEKLPLMAKGRDF 173 Corynebacterium...
WP_002246529  85 FHVSRQFWATLVAEGKLED-NSFINAVPHMSLVMNEDHCSYLQKRYDAFKTQKLFENMEFSTDRNKISDWAPLMMRGRDE 163 Neisseria menin...
WP_023129351  89 FEVSKQFWSHLVAKGTFGSPKTFINPVPHLSFVRGSEGIAYLKKRFESLTKHHAFETMVYSEDKATLAEWMPLMMPGRPA 168 Pseudomonas aer...
O05807       167 SEPVALNWAADGTDVDFGALAKQLIGYCVQN-GTTALFGHEVRNLSRQSdGSWTVTMCNRRT-GEKRKLNTKFVFVGAGG 244 Mycobacterium t...
CAA12237     174 SDPVAISWIDEGTDINYGAQTKQYLDAAEVE-GTEIRYGHEVKSIKADG-AKWIVTVKNVHT-GDTKTIKANFVFVGAGG 250 Corynebacterium...
WP_002246529 164 NQPVAANYSAEGTDVDFGRLTRQMVKYLQGK-GVKTEFNRHVEDIKRESdGAWVLKTADTRNpDGQLTLRTRFLFLGAGG 242 Neisseria menin...
WP_023129351 169 DEAIAATRVEGGTDVNFGALTNQLLQHLAQQpGAQIRYNQKVTHLRR-AdNGWRVTVKDTRN-GGDREIQARFVFLGAGG 246 Pseudomonas aer...
O05807       245 DTLPVLQKSGIKEVKGFAGFPIGGRFLRAGNPALTASHRAKVYGFPAPGAPPLGALHLDLRFVNGKSWLVFGPYAGWSPK 324 Mycobacterium t...
CAA12237     251 YALDLLRSAGIPQVKGFAGFPVSGLWLRCTNEELIEQHAAKVYGKASVGAPPMSVPHLDTRVIEGEKGLLFGPYGGWTPK 330 Corynebacterium...
WP_002246529 243 GALTLLQKSGIPEGKGYGGFPVSGLFFRNSNPETAEQHNAKVYGQASVGAPPMSVPHLDTRNVDGKRHLMFGPYAGFRSN 322 Neisseria menin...
WP_023129351 247 GALPLLQLSGIPEGKGFGGFPVSGQWLRCDNPEIVKQHQAKVYSQAEVGSPPMSVPHLDTRVVDGKKSLLFGPYAGFSTK 326 Pseudomonas aer...
O05807       325 FLKHGQISDLPRSIRPDNLLSVLGVGLTERRLLNYLISQLRLSEPERVSALREFAPSAIDSDWELTIAGQRVQVIRRD-E 403 Mycobacterium t...
CAA12237     331 FLKEGSYLDLFKSIRPDNIPSYLGVAAQEFDLTKYLVTEVLKDQDKRMDALREYMPEAQNGDWETIVAGQRVQVIKPAgF 410 Corynebacterium...
WP_002246529 323 FLKQGSLMDLPLSIHMDNLYPMLRAGWANMPLTKYLLGELRKTKEERFASLLEYYPEANPDDWELITAGQRVQIIKKDsE 402 Neisseria menin...
WP_023129351 327 FLRHGSFLDLPLSVRPGNILPMLSVARDNMDLTRYLIGQVMQSPEQRLEALRKFYPEARAEDWRLEVAGQRVQIIKKDpK 406 Pseudomonas aer...
O05807       404 RNGGVLEFGTTVIGDADGSIAGLLGGSPGASTAVAIMLDVLQKCFANRYQS--WLPTLKEMVPSLGVQLSNEPALFDEVW 481 Mycobacterium t...
CAA12237     411 PKFGSLEFGTTLINNSEGTIAGLLGASPGASIAPSAMIELLERCFGDRMIE--WGDKLKDMIPSYGKKLASEPALFEQQW 488 Corynebacterium...
WP_002246529 403 KG-GVLQFGTEIVAHADGSLAALLGASPGASTAVPLMIRLMHQCFPERTPS--WEGRLKELVPGYGIKLNENPERADEII 479 Neisseria menin...
WP_023129351 407 KG-GILQFGTELVAAHDGSIAALLGASPGASVTVSIMLGLIERCFPEQARSpeWSAKLKEIFPAREKELESDAELYRSVS 485 Pseudomonas aer...
O05807       482 SWSTKAL 488 Mycobacterium tuberculosis
CAA12237     489 ARTQKTL 495 Corynebacterium glutamicum
WP_002246529 480 AYTAKVL 486 Neisseria meningitidis
WP_023129351 486 SRCSEVL 492 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap