Conserved Protein Domain Family
glmL_fam

?
TIGR01319: glmL_fam 
conserved hypothetical protein
This small family includes, so far, an uncharacterized protein from E. coli O157:H7 and GlmL from Clostridium tetanomorphum and Clostridium cochlearium. GlmL is located between the genes for the two subunits, epsilon (GlmE) and sigma (GlmS), of the coenzyme-B12-dependent glutamate mutase (methylaspartate mutase), the first enzyme in a pathway of glutamate fermentation. Members shows significant sequence similarity to the hydantoinase branch of the hydantoinase/oxoprolinase family (pfam01968).
Statistics
?
PSSM-Id: 130386
View PSSM: TIGR01319
Aligned: 2 rows
Threshold Bit Score: 795.777
Threshold Setting Gi: 730087
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_001167714   6 VDIGSTWTKAALFTREGDALTLVNHVLTPTTTHHLAKgfFSSLNQVLNVDNALPLLNsgEVALKYSSSAKGGLAVAAMGL 85  Escherichia coli
Q05491         7 LDFGSTYTKLTAVDIENEGILATAKDITTIESDIMVG--FNKAYEKLTEQLEGKEVN--FVKKLACSSAAGGLKMIAIGL 82  Clostridium tet...
WP_001167714  86 VPSITLETAKVTAHSAGAKIAQYYAYKLNRRDIQALEETQPDILLFTGGTDGGEESYGLNNARVLAESKLDCAIIYAGNR 165 Escherichia coli
Q05491        83 VPELTAEAAKRAALGAGARVLNVYSYDLTNKEVEEIKNSNLDIILLAGGTDGGNKECMIHNAKMLAEHGVKLPIVVAGNK 162 Clostridium tet...
WP_001167714 166 DIQDEVQEILGHKDLT--IVDNVLPDLDHPNPVAARQAICDIFLKRIVKGKGLDVIVDKTGEEPMPTPWTVFELVKAISN 243 Escherichia coli
Q05491       163 VVSDEVSEIFDKAGIFyrVTENVMPKLNTLNVEPAREEIRQIFMKKIVEAKGMSNAESFINGILMPTPAAVLKAARVLAE 242 Clostridium tet...
WP_001167714 244 ---VDHSWKEFMLIDMGGATTDVYSACANTLS-PDTVLHGVPEPFVKRTVEGDLGMRVSAVVVGES-AKELVNVNFAQQP 318 Escherichia coli
Q05491       243 gtdKEDGIGDLIVVDIGGATTDVHSLADGEPSkPGVTLRGLEEPFAKRTVEGDLGMRYSAISLWEAsGTRKLQKYLCDNT 322 Clostridium tet...
WP_001167714 319 AQLDAFYHYLrhlVAHPDYLPANAEEKYFDTVLAGLCVGYATERHAGTKKEVCTCVGNVDLQMGRDLTTVRKVVGSGGWL 398 Escherichia coli
Q05491       323 VDVEACCKYR---AEHIKMVPETEEEIKFDEAMAKVATDMAMERHVGVIESMYTPMGVIYSQIGKDLLNVKCVIGTGGVL 399 Clostridium tet...
WP_001167714 399 SRAsqFDMHHWLKYRELNDDGKRILLPTEFEYYRDSRGLLPLLANVARVDPLAAARTSIQCLT 461 Escherichia coli
Q05491       400 VHS--KNPGEILKAGSFDMADATHLKPQHPEYYIDKTYILSAMGLLAEDLPDKAVRIMKKYLV 460 Clostridium tetanomorphum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap