Conserved Protein Domain Family
GOGAT_sm_gam

?
TIGR01317: GOGAT_sm_gam 
glutamate synthases, NADH/NADPH, small subunit
This model represents one of three built for the NADPH-dependent or NADH-dependent glutamate synthase (EC 1.4.1.13 and 1.4.1.14, respectively) small subunit or homologous region. TIGR01316 describes a family in several archaeal and deeply branched bacterial lineages of a homotetrameric form for which there is no large subunit. Another model describes glutamate synthase small subunit from gamma and some alpha subdivision Proteobacteria plus paralogs of unknown function. This model describes the small subunit, or homologous region of longer forms proteins, of eukaryotes, Gram-positive bacteria, cyanobacteria, and some other lineages. All members with known function participate in NADH or NADPH-dependent reactions to interconvert between glutamine plus 2-oxoglutarate and two molecules of glutamate.
Statistics
?
PSSM-Id: 162300
View PSSM: TIGR01317
Aligned: 5 rows
Threshold Bit Score: 824.849
Threshold Setting Gi: 499189288
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q12680       1640 KTRGFMIHKRRHETHRDPR-T-RVNDWKEFTNPITKKDAKYQTARCMDCGTPFCLS-------DTGCPLSNIIPKFNELL 1710 Saccharomyces...
WP_010871407    3 KPTGFLEYTREIPQELSPG-D-RLRNWDEFHVTMPDKQVETQGARCMDCGTPFCHTgslisgmASGCPINNLIPEFNDLV 80   Synechocystis...
WP_003231462    3 KPTGFMEIKREKPAERDPL-T-RLKDWKEYSAPFSEEASKRQGARCMDCGTPFCQIgadingfTSGCPIYNLIPEWNDLV 80   Bacillus subt...
WP_003916203   31 DPGGFLKYTHRKLPKRRPVpL-RLRDWREVYEEFDNESLRQQATRCMDCGIPFCHN---------GCPLGNLIPEWNDLV 100  Mycobacterium...
WP_010886828    3 KITGFLE-QPRVKEQYAPI-DaRLKHYHEFMLPLDSASARLQATRCMDCGIPFCNN---------GCPVNNIIPDFNNLV 71   Deinococcus r...
Q12680       1711 FKNQWKLALDKLLETNNFPEFTGRVCPAPCEGACTLGIIEDPVGIKSVERIIIDNAFKEGWIKPCPPSTRTGFTVGVIGS 1790 Saccharomyces...
WP_010871407   81 YRGLWREALDRLHKTNNFPEFTGRVCPAPCEGSCVLGINNPPVTIKNIEYSIIEKGWQEGWVTPEPPAKRTGKKVAVVGS 160  Synechocystis...
WP_003231462   81 YRGRWKEALERLLKTNNFPEFTGRVCPAPCEGSCTLAISDPAVSIKNIERTIIDKGFENGWIQPRIPKKRTGKKVAIVGS 160  Bacillus subt...
WP_003916203  101 RRGRWRDAIERLHATNNFPDFTGRLCPAPCEPACVLGINQDPVTIKQIELEIIDKAFDEGWVQPRPPRKLTGQTVAVVGS 180  Mycobacterium...
WP_010886828   72 FEDDWKAALDVLHATNNFPEFTGRICPAPCEAACTLNISEDPVGIKSIELAIIERGWQEGWVRPTPAEVKTGKKVAVVGS 151  Deinococcus r...
Q12680       1791 GPAGLACADMLNRAGHTVTVYERSDRCGGLLMYGIPNMKLDKA-IVQRRIDLLSAEGIDFVTNTEIG------------- 1856 Saccharomyces...
WP_010871407  161 GPAGLAAAAQLNKAGHWVTVYEREDRPGGLLMYGIPNMKLDKEeVVLRRLNVLEAEGVTFVCNTEIG------------- 227  Synechocystis...
WP_003231462  161 GPAGLASADQLNQAGHSVTVFERADRAGGLLTYGIPNMKLEKG-IVERRIKLLTQEGIDFVTNTEIG------------- 226  Bacillus subt...
WP_003916203  181 GPAGLAAAQQLTRAGHTVTVFEREDRIGGLLRYGIPEFKMEKR-HLDRRLDQMRSEGTEFRPGVNVG------------- 246  Mycobacterium...
WP_010886828  152 GPAGLAAAQQLARAGHDVTVFEKNDRVGGLVRYGIPDFKLDKS-HIDRRIEQMQAEGVTFRTGVLVGdwdenskitnlsk 230  Deinococcus r...
Q12680       1857 KTISMDELKNKHNAVVYAIGSTIPRDLPIKGRELKNIDFAMQLLESNTKALLNKDL-EII---REKIQGKKVIVVGGGDT 1932 Saccharomyces...
WP_010871407  228 KDLPPETLLKDYDAVVLCTGATKPRDLAIAGRELEGIHFAMEFLTANTKAILDKTP-GPN---FISAKDKDVVIIGGGDT 303  Synechocystis...
WP_003231462  227 VDITADELKEQFDAVILCTGAQKQRDLLIEGRDSKGVHYAMDYLTLATKSYLDSNFkDKQ---FIDAKGKDVIVIGGGDT 303  Bacillus subt...
WP_003916203  247 VDISAEKLRADFDAVVLAGGATAWRELPIPGRELEGVHQAMEFLPWANRVQEGDDVlDEDgqpPITAKGKKVVIIGGGDT 326  Mycobacterium...
WP_010886828  231 ERVTPAELREQFDAVVLAGGSETPRDLPAPGRELNGIHYAMEFLPQQNRVNAGDKFkG-----QIRADGKHVVVIGGGDT 305  Deinococcus r...
Q12680       1933 GNDCLGTSVRHGAASVLNFELLPEPPVERAKDNPWPQWPRVMRVDYGHAEVKEHYGRDPREYCILSKEFIGNDEGEVTAI 2012 Saccharomyces...
WP_010871407  304 GTDCVGTSLRHGCRSLVQLEIMPKPPEERAANNPWPEWPKVYKMDYGQEEAAAVYGHDPRSYLTTATKIEGDDQGRVKAV 383  Synechocystis...
WP_003231462  304 GADCVATALRQKAKSVHQFGKHPKLPPARTNDNMWPEQPHVFTLEYAYEEAEAKFGRDPREYSIQTTKMVADKNGKLKEL 383  Bacillus subt...
WP_003916203  327 GADCLGTVHRQGAIAVHQFEIMPRPPDARAESTPWPTYPLMYRVSAAHEE----GG--ERVFSVNTEAFVGTD-GRVSAL 399  Mycobacterium...
WP_010886828  306 GSDCVGTSNRHGAAGVTQFEVMPQPPEQENKPLTWPYWPMKLRTSTSHEEGA------VREFAIATKEFIGKG-GKVTGV 378  Deinococcus r...
Q12680       2013 RTVRVEWKKSQSGVWQMVEIPNSEEIFEADIILLSMGFVGPELI-NGNDNEVKKTRRGTI-ATLDDSS---YSIDGgkTF 2087 Saccharomyces...
WP_010871407  384 HTVDVRWEKDGQGRFIPQQVAGTEQVRPAQLVLLAMGFVGPESQ-LLDAMKLDKDARGNIkAEYGQYE---TSIPG--VF 457  Synechocystis...
WP_003231462  384 HTIQMEKVKNEHGKYEFRELPGTEKVWPAQLVFIAIGFEGTEQP-LLKQFGVN-SVNNKIsAAYGDYQ---TNIDG--VF 456  Bacillus subt...
WP_003916203  400 RAHEVTML---DGK--FVKVEGSDFELEADLVLLAMGFVGPERAgLLTDLGVKFTERGNVaRGDDFD----TSVPG--VF 468  Mycobacterium...
WP_010886828  379 RTVRVEMK---DGK--LEEIPGSEETHKADLVLLAMGFTNPMQS-VLDAFGVDKDPRGNVlAGTEEHGgylTSVPG--VF 450  Deinococcus r...
Q12680       2088 ACGDCRRGQSLIVWAIQEGRKCAASVDKFLMDgTTYLP 2125 Saccharomyces cerevisiae S288c
WP_010871407  458 AAGDCRRGQSLVVWAFNEGRGAAKACDLYLMG-ETDLP 494  Synechocystis sp. PCC 6803
WP_003231462  457 AAGDARRGQSLIVWAINEGREVAREVDRYLMG-SSVLP 493  Bacillus subtilis
WP_003916203  469 VAGDMGRGQSLIVWAIAEGRAAAAAVDRYLMG-SSALP 505  Mycobacterium tuberculosis
WP_010886828  451 AAGDMRRGQSLVVWAIREGRQAARAVDQFLMG-ESVLP 487  Deinococcus radiodurans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap