Conserved Protein Domain Family
gltA

?
TIGR01316: gltA 
glutamate synthase (NADPH), homotetrameric
This protein is homologous to the small subunit of NADPH and NADH forms of glutamate synthase as found in eukaryotes and some bacteria. This protein is found in numerous species having no homolog of the glutamate synthase large subunit. The prototype of the family, from Pyrococcus sp. KOD1, was shown to be active as a homotetramer and to require NADPH. [Amino acid biosynthesis, Glutamate family]
Statistics
?
PSSM-Id: 130383
View PSSM: TIGR01316
Aligned: 3 rows
Threshold Bit Score: 750.547
Threshold Setting Gi: 499184640
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010881350  17 PPEERVKTFREFELGYSVNLALDEAQRCLFCKDAEQRCIKGCPVHVDIPGFIKKITEGDLVGAYKVITQSDIFPSICGRV 96  Aquifex aeolicus
WP_010884968  15 PVEERIKDFKEVNLGYTFELAKKEAERCLQCPPEYAPCIKGCPVHINIPAFIAKIKEGDIKGALRIIWNDNTLPAITGRV 94  Pyrococcus hori...
WP_010882180  66 PPKKRSLLMQEAALGFTEQQALVESQRCLNCK--TKPCVKGCPVGVPIPEFIACVQRGAFKEAVDIIKTTSLLPAICGRV 143 Treponema pallidum
WP_010881350  97 CPQERQCEGSCILYydtvRnrknKGLPVAIGALEKFVGDFIRISGIEIE-----EEKEPPTGFRVAVIGAGPAGLSCAHE 171 Aquifex aeolicus
WP_010884968  95 CPQEDQCEGACVVG----K----VGDPVNIGKLERFVADYAREHGIEEEllrefTEKCDGSKGKVAVVGAGPAGLTCAGE 166 Pyrococcus hori...
WP_010882180 144 CPHERQCQLQCTVG----KmfkdVSKAVSIGALERFVADWERQHGQITV-----PYCAPSTHKKVAVIGSGPAGLAVASD 214 Treponema pallidum
WP_010881350 172 LAKKGHEVHVYEALPKPGGVMYYGIPNARLDKSIIEWEVKRLEKLGIKFFYGYLIGKNITLQELREKY--DAVFIAVGAG 249 Aquifex aeolicus
WP_010884968 167 LAKMGYKVTIFEALHKPGGVLAYGIPEFRLPKEILDHELKKLKMLGVEIRTDHVVGKTVTLDELLQEY--DAVFIGTGAG 244 Pyrococcus hori...
WP_010882180 215 TARAGHSVTVFEALHKPGGVVTYGIPEFRLPKEVVVTEIETLKKMGVTFRMNFLVGRTATLEQLFSQYgfDAVFIGTGAG 294 Treponema pallidum
WP_010881350 250 RGKLG-LPGDHLKGVYSAIDFLMRVNLYKANEFPKKGVPVELGKRTVIIGGGFTAVDCAITANRLGVE-THVVYRRTRET 327 Aquifex aeolicus
WP_010884968 245 TPKLLnIPGILLDRIYSANEFLTRINLMKAYEFPEYDTPIAVGKKVIVIGAGNTAMDAARSALRLGAE-VTIAYRRGRED 323 Pyrococcus hori...
WP_010882180 295 LPRFMnIEGEELCGVFAANDYLTRATLMKAYDTAHADTPVYAAKSVVVVGGGNVAVDSSRTALRLGAEqVHCLYRKTRAD 374 Treponema pallidum
WP_010881350 328 SSARQEEWDHLMEEGVKIHWLTQPVEVIGNEKGEVVGLKCIKMELGEPDESGRPRPVPVPNSEHIIECDSVIFAIGQRAN 407 Aquifex aeolicus
WP_010884968 324 MTAREEEIKHAEEEGVKFEFFLQPVEFIGDENGRVKAVKFERTKPLEERDSKGKRKIVGTGEYVTLEADTVIIAIGLEPN 403 Pyrococcus hori...
WP_010882180 375 MTACVEEIAQAEDEGVTFHFLCQTTRILGDEEGNVRAVVFR--DCQEQIDAGERVFLPCGDAECKLAADAVIVAVGNGSN 452 Treponema pallidum
WP_010881350 408 PIAYEGSG-IKTTKWGTIEVNERYETNLEGVFAGGDVINGGDRVVVALAHGKEAAKYIHEYL 468 Aquifex aeolicus
WP_010884968 404 KIITEDGR-LKTNPDGTIVVDENLMTSIPGVFAGGDAIRGEATVILAMGDGKRAAKAIDEYI 464 Pyrococcus horikoshii
WP_010882180 453 PLMAKTTRsLAVSERGTIVVDEDQRTSIPGVWAGGDIVLGAATVIRAMGQGRRAAASINAYL 514 Treponema pallidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap