Conserved Protein Domain Family
gntK_FGGY

?
TIGR01314: gntK_FGGY 
gluconate kinase, FGGY type
Gluconate is derived from glucose in two steps. This model describes one form of gluconate kinase, belonging to the FGGY family of carbohydrate kinases. Gluconate kinase phosphoryates gluconate for entry into the Entner-Douderoff pathway. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 130381
View PSSM: TIGR01314
Aligned: 3 rows
Threshold Bit Score: 935.482
Threshold Setting Gi: 499208828
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P12011         4 YMLGIDIGTTSTKAVLFSENGDVVQKESIGYPLYTPDISTAEQNPEEIFQAVIHTTARITKQHPEK-R-ISFISFSSAMH 81  Bacillus subtil...
WP_000876663   3 YMIGVDIGTTSTKSVLYDENGTFIMKHQIGYDLHTPNVDVSEENPDELFDAVLMTIKYVMRESKVNkDdIKFVSFSAQMH 82  Staphylococcus ...
WP_010906368   3 YLIGVDLGTTATKAVLFEKNGKIVASSSQAYPLYRDASGMAEESLEEIFEAVLVTIREVSINLEDE-DeLLAVSFSTQMH 81  Lactococcus lactis
P12011        82 SVIAIDENDKPLTPCITWADNRSEGWAHKIKEELNGHEVYKRTGTPIHPMAPLSKIAWITNERKEIASKAKKYIGIKEYI 161 Bacillus subtil...
WP_000876663  83 SLIAMDQQHQRLTNNITWADNRAAKYATVINEVHDGNAIYQRTGTPIHPMSPLAKIFWMKHEWQDVFQRTAKFADIKTYI 162 Staphylococcus ...
WP_010906368  82 SLIAFDENWQPLTRLITWADTRAVKYTEQIKASKNGFDIYRRTETPLHPMAPLSKFIWLEAEHPDIYQKAAHYLELKGYI 161 Lactococcus lactis
P12011       162 FKQLFNEYVIDYSLASATGMMNLKGLDWDEEALRIAGITPDHLSKLVPTTEIFQHCSPEIAIQMGIDPETPFVIGASDGV 241 Bacillus subtil...
WP_000876663 163 FYHLFDTYIIDYSMASATGMFNLETLDWDVEALELLGISKEMLPELVPTTYVMKGMKERYATLMGLNKDTPFVIGASDGV 242 Staphylococcus ...
WP_010906368 162 FQRLFGTNKMDLSTATGTGIFNIFELHWDKEALELTGIKESQLPKVVEPYEIEENLPHEYAKKMGIQSSTKFIWGAADGP 241 Lactococcus lactis
P12011       242 LSNLGVNAIKKGEIAVTIGTSGAIRTIIDKPQTDEKGRIFCYALTDKHWVIGGPVNNGGIVLRWIRDEFASSEIETATRL 321 Bacillus subtil...
WP_000876663 243 LSNLGVNSVGKGEVAVTIGTSGAIRTVIDKPRTDYKGRIFCYVLTEDHYVIGGPVNNGGVVLRWLRDELLASEVETAKRL 322 Staphylococcus ...
WP_010906368 242 LSNLGVNAIKPGVAAITIGTSGAIRVVTDKPKTDEKGRTFTYALDKEHWVVGGPVNSGGDVFRWARDQIFDGKIS----- 316 Lactococcus lactis
P12011       322 GIDPYDVLTKIAQRVRPGSDGLLFHPYLAGERAPLWNPDVRGSFFGLTMSHKKEHMIRAALEGVIYNLYTVFLALTECMD 401 Bacillus subtil...
WP_000876663 323 GVDPYDVLTQIAKRVKPGADGLIFHPYLAGERAPLWNANARGSFFGLTLSHKKEHMIRAALEGVLYNLYTVYLALIEVMN 402 Staphylococcus ...
WP_010906368 317 ----FDEVTELAANISPGADGLLFHPYLGGERAPIWDANARGSFFGLNYGHNRSHMARSVLEGVIFNIYMVALSLVEVVG 392 Lactococcus lactis
P12011       402 GPVTRIQATGGFARSEVWRQMMSDIFESEVVVPESYESSCLGACILGLYATGKIDSFDAVSDMIGSTYRHTPIEDSAKEY 481 Bacillus subtil...
WP_000876663 403 ETPKMIKATGGFAKSEVWRQMMSDIFDTELVVPESYESSCLGACVLGLKAVGDIEDFSIVSSMVGATNNHTPIEENVTVY 482 Staphylococcus ...
WP_010906368 393 D-LNMIQATGGFTSSELWTQILADIFEQPINVPESREAGCLAAIIMAEKALGLIEDISEIETMVGTNETYQPNPKNFEIY 471 Lactococcus lactis
P12011       482 RTLMPIFINLSRLLENQYTQIADYQR 507 Bacillus subtilis subsp. subtilis str. 168
WP_000876663 483 QEIVSIFINLSRSLTENYEQIADFQR 508 Staphylococcus aureus
WP_010906368 472 REISPIFIRLSRSLLAEYENIANFQR 497 Lactococcus lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap