Conserved Protein Domain Family
uL30_arch

?
TIGR01309: uL30_arch 
50S ribosomal protein uL30, archaeal form
This model represents the archaeal ribosomal protein similar to longer (~ 250 residue) eukaryotic 60S ribosomal protein L7 and to the much shorter (~ 60 residue) bacterial 50S ribosomal protein L30. Protein naming follows the SwissProt designation as L30P, while the gene symbol rpmD follows TIGR usage. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130376
View PSSM: TIGR01309
Aligned: 7 rows
Threshold Bit Score: 209.938
Threshold Setting Gi: 150421646
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9YF96         4 YAVIRIRGTVDVPPDIDKTLYLLRLRRRYTASIYHDSlPGLRDMLRTVEAWTTYGEIEERVLEELLRKRGR-IVGDKPLT 82  Aeropyrum perni...
P54046         3 YAVIRIRGRVGVRRDIADTLKMLRLHKVNHCVIIPET-ETFKGMLQKVKDYVTWGEIDKDTLVKLILKRGR-LPGNKKVN 80  Methanocaldococ...
O26132         2 FAVVRVRGSAGVRRDIADTMEMLRLNRINHAVLVEDT-PSYLGMLQKAKDYITWGEVDQETLTAMIRKRGR-LIGGDRIT 79  Methanothermoba...
O28375         2 FAVVRMRGTVDVHRKIKETLKMLRLHKRYHCVVIPDT-PSYRGMLQVVKDYVAYGEINAETLALLLRLRGR-LTGNRKLT 79  Archaeoglobus f...
WP_010903255   2 QALVQVRGPVDMSRDIQDTLEMLNIHSVNHCALVPET-DTYSGMVAKVNDYVAFGEPSEAVLTDLIESRGEpASGAGDVD 80  Halobacterium s...
WP_010916604   2 LAVIRIRGRTGIKQDIEDTAHLLRLNRINHLVLLQED-AVTKGMLQKVKDYVTWGEIDVDTLEVLLKNRCL-FKGRRKLT 79  Thermoplasma vo...
WP_009991253   5 LGIIRIRGWAKAPWYINETLNMLRLRYNFNTMVYPKT-SQILGMLNKVSPYITWGEIDPDTLKLLIINRLE-TVKGDKVS 82  Sulfolobus solf...
Q9YF96        83 DKWVEENLGLSgLGELAEKLVSGEL---HyhrLEEKG-VKPFFRLHPPRGGFK-KSIKRMFRDGGELG-YRGSAINELIL 156 Aeropyrum perni...
P54046        81 PEIIKELTGMD-VEELAEKIINGEI---K---LKETP-LKPVFRLHPPRKGFErGGIKKPFSVGGALG-YRGEKINELLE 151 Methanocaldococ...
O26132        80 DEYINEKTAYGsVDEFAAAVFSGEV---K---LEEAG-IKPVFRLHPPRKGYE--GIKKAFNEGGSLG-YRGEKINDLLK 149 Methanothermoba...
O28375        80 DEYVKEKTGYEtIEEFAKAVVEGKA---S---LKDLPdLKPVFRLHPPRKGIK-N-IKWHYPRG-NLG-YHGEEINRLLY 149 Archaeoglobus f...
WP_010903255  81 DAWVAEHTEYDdVADLAGALLAEET---T---LSDAG-LAPVIRLHPPRGGHD--GIKTPASDGGQLGkHTTEEIDHLLT 151 Halobacterium s...
WP_010916604  80 EEELKDVTGFGsYRDLAKALVDGKI---K---FSEINdVVPVIRLNPPYKGYE--AIKTSYRNGGSAG-YRGKDINNLIR 150 Thermoplasma vo...
WP_009991253  83 DSYVKEVLKIEnIDAMVKQLYEGKIylhK---LDEY--FKLPIRLHPPRGGFK-GSVKRPYKNKGEFG-YRGDKINELMR 155 Sulfolobus solf...
Q9YF96       157 KML 159 Aeropyrum pernix K1
P54046       152 KMM 154 Methanocaldococcus jannaschii DSM 2661
O26132       150 RMI 152 Methanothermobacter thermautotrophicus str. Delta H
O28375       150 KMR 152 Archaeoglobus fulgidus DSM 4304
WP_010903255 152 DMR 154 Halobacterium salinarum
WP_010916604 151 RMI 153 Thermoplasma volcanium
WP_009991253 156 RMV 158 Sulfolobus solfataricus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap