Conserved Protein Domain Family

TIGR01308: rpmD_bact 
Click on image for an interactive view with Cn3D
ribosomal protein L30, bacterial/organelle
This model describes bacterial (and organellar) 50S ribosomal protein L30. Homologous ribosomal proteins of the eukaryotic cytosol and of the archaea differ substantially in architecture, from bacterial L30 and also from each other, and are described by separate models. [Protein synthesis, Ribosomal proteins: synthesis and modification]
PSSM-Id: 130375
Aligned: 13 rows
Threshold Bit Score: 56.1666
Threshold Setting Gi: 7674266
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q9XD18        4 IIVTQVKSSIGVKKEHKLTLHALGLRRTGQQRKHKISPQLQGMLNSVRHLIKVEK 58  Leptospira interrogans serovar Lai str. 5...
Q9XD18        4 IIVTQVKSSIGVKKEHKLTLHALGLRRTGQQRKHKISPQLQGMLNSVRHLIKVEK 58  Leptospira interrogans serovar Lai str. 5...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap