Conserved Protein Domain Family
pgm_bpd_ind

?
TIGR01307: pgm_bpd_ind 
phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
This protein is about double in length of, and devoid of homology to the form of phosphoglycerate mutase that uses 2,3-bisphosphoglycerate as a cofactor. [Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 130374
View PSSM: TIGR01307
Aligned: 8 rows
Threshold Bit Score: 786.958
Threshold Setting Gi: 499205843
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P56196         3 QKTLLIITDGIGYRKDS---DHNAFFHAKKPTYDLMFKTLP-----YSLIDTHGLSVGLPKGQMGNSEVGHMCIGAGRVL 74  Helicobacter py...
P37689         6 KPMVLVILDGYGYREEQ---QDNAIFSAKTPVMDALWANRP-----HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIV 77  Escherichia col...
P74507         7 APVVLVILDGWGYRPDT---RANAIAQANTPIMDSLIAAYP-----NTLVNTSGKDVGLPKGQMGNSEVGHLNLGAGRVV 78  Synechocystis s...
BAB12237       6 QKVVLVVIDGWGVAGPDsrkDGDAILAAETPFMSGFAEADSktaqgYSELDASSLAVGLPEGLMGNSEVGHLNIGAGRVV 85  Aspergillus oryzae
P75167         3 KKVLLAILDGYGISNKQ---HGNAVYHAKTPALDSLIKDYP-----CVMLEASGEAVGLPQGQIGNSEVGHLNIGAGRIV 74  Mycoplasma pneu...
P47669         3 KKVLLAILDGYGISNAI---YGNAVQNANTPMLDELINSYP-----CVLLDASGEAVGLPMGQIGNSEVGHLNIGAGRVV 74  Mycoplasma geni...
WP_003114478   6 KPLVLIILDGFGHSESP---DYNAIYAAKKPVWDRLLATQP-----HGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVV 77  Pseudomonas aer...
WP_010903383   1 MQAALVILDGWGLGDHD---RRDAVRAADTPTFDEYAERGA-----FGTLTTSGRDVGLPDGQMGNSEVGHLTIGAGRVV 72  Halobacterium s...
P56196        75 YQDLVKISLSLQNDELKNNPAFLNTIQ---K-SPVVHLMGLMSDGGVHSHIEHFIALALECEKS-HKKVCLHLITDGRDV 149 Helicobacter py...
P37689        78 YQDLTRLDVEIKDRAFFANPVLTGAVDkakNaGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERgAEKIYLHAFLDGRDT 157 Escherichia col...
P74507        79 PQELVRISDAIEDGTFFDNQALIEVCQrvrDrRGKLHLIGLCSDGGVHSHIDHLLGLIDLAKLQgISQLCIHAITDGRDT 158 Synechocystis s...
BAB12237      86 WQDSVRIDQTLKKGELNKVDNVVASFKrakEgNGRLHLLGLVSDGGVHSNITHLIGLLKVAKEMeIPKVFIHFFGDGRDT 165 Aspergillus oryzae
P75167        75 YTGLSLINQNIKTGAFHHNQVLLEAIArakAnNAKLHLIGLFSHGGVHSHMDHLYALIKLAAPQ--VKMVLHLFGDGRDV 152 Mycoplasma pneu...
P47669        75 YTGLSLINQHIKDRSFFANKAFLKTIEhveKnHSKIHLIGLFSNGGVHSHNEHLLALIELFSKH--AKVVLHLFGDGRDV 152 Mycoplasma geni...
WP_003114478  78 YQDFTRVTKAIRDGEFFENPVIAGAVDkavAaDKAVHILGLLSPGGVHSHEDHLVAMAQMAARRgAGKIYLHAFLDGRDT 157 Pseudomonas aer...
WP_010903383  73 KQAYTRIEDAIAAGDLCGNDAISGALDhvaDtGGTLHVMGLVSDGGVHADQQHIHALVECAAGRgVEAAV-HAFTDGRDT 151 Halobacterium s...
P56196       150 APKSALTYLKQMQNICN--ESIQIATISGRFYAMDRDKRFERIELAYHSLMGLNH-TPLS-PSEYI--QSQYDKNITDEF 223 Helicobacter py...
P37689       158 PPRSAESSLKKFEEKFAalGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGeFQADtAVAGL--QAAYARDENDEF 235 Escherichia col...
P74507       159 PTNEGAHFVQQIQAHLEkiGLGRIVSVSGRYYALDRDRRWDRVEKAYRVMT-EDGvGDGRsAAQVI--KDYYASDITDEF 235 Synechocystis s...
BAB12237     166 EPKSATKYMQQLLDQTKeiGIGEIATVVGRYWAMDRDKRWDRVEIAMKGIVSGEG-EESSdPVKTI--NERYEKDETDEF 242 Aspergillus oryzae
P75167       153 APCTMKSDLEAFMVFLKdyHNVIIGTLGGRYYGMDRDQRWDREEIAYNAILGNSK-ASFTdPVAYV--QSAYDQKVTDEF 229 Mycoplasma pneu...
P47669       153 APCSLKQDLEKLMIFLKnyPNVVIGTIGGRYYGMDRDQRWDREMIAYKALLGVSK-NKFNdPIGYI--ETQYQNQITDEF 229 Mycoplasma geni...
WP_003114478 158 PPKSAQPSLERLDATFAglGKGRIASIIGRYFAMDRDNRWDRVQAAYELIVDGKAeFTADsSVAAL--EAAYARGESDEF 235 Pseudomonas aer...
WP_010903383 152 SPTGGEDYLADLEAVADehGTGDVASVSGRYYAMDRDQNWARTKRAYDAITRSDG-VAHHaAAAVDavTDSYERGDTDEF 230 Halobacterium s...
P56196       224 IMPACFKNYC----G----MQDDESFIFINFRNDRAREIVSALGQ---KQFSGFKRQVFKKLH--IATMTPYDNTFPYPV 290 Helicobacter py...
P37689       236 VKATVIRAEGqpdaA----MEDGDALIFMNFRADRAREITRAFVN---ADFDGFARKKVVNVD--FVMLTEYAADIKTAV 306 Escherichia col...
P74507       236 IPPTRIGAg-----A----IASGDGVIFYNFRPDRARQLCYALVN---PSFDGFPRERIQPLD--FVTFTQYDPALPVVV 301 Synechocystis s...
BAB12237     243 LKPIIVGGee---rR----VKDDDTLFFFNYRSDRVREITQLLGDydrSPKPDFPYPKNIHIT----TMTQYKTDYTFPV 311 Aspergillus oryzae
P75167       230 LYPAVNGNVDkeqfA----LKDHDSVIFFNFRPDRARQMSHMLFQ---TDYYDYTPKAGRKYNlfFVTMMNYEGIKPSAV 302 Mycoplasma pneu...
P47669       230 IYPAINANLNsdqfA----LNNNDGVISFNFRPDRARQMSHLIFN---SNYYNYQPELKRKENlfFVTMMNYEGIVPSEF 302 Mycoplasma geni...
WP_003114478 236 VKATAVVPAG----AeavrVEDGDAVIFMNFRADRARELSRAFVE---PAFNEFPRERAPQLAg-FVMLTQYAASIPAPC 307 Pseudomonas aer...
WP_010903383 231 VEPTTIEGGA----A----LSDGDAVVFANFRADRARQLTRLLADihpADWDADGIETNPPAVp-VVTMTEYDETFDCPV 301 Halobacterium s...
P56196       291 LFPKESVQNTLAEVVSQHNLTQSHIAETEKYAHVTFFINGGVETPFKNENRVLIQSPKVTTYDLKPEMSAKEVTLAVLEQ 370 Helicobacter py...
P37689       307 AYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAA 386 Escherichia col...
P74507       302 AFEPQNLNNILGEIISRQGMKQFRTAETEKYPHVTYFFNGGLEQPFAGEDRELIQSPMVSTYDKAPQMSAKAVTDAVCRA 381 Synechocystis s...
BAB12237     312 AFPPQHMGNVLAEWLSKKDVQQCHVAETEKYAHVTFFFNGGIEKQFAGEVRDMIPSPKVATYDLDPKMSAEAVGQKMADR 391 Aspergillus oryzae
P75167       303 VFPPETIPNTFGEVIAHNKLKQLRIAETEKYAHVTFFFDGGVEVDLPNETKCMVPSLKVATYDLAPEMACKGITDQLLNQ 382 Mycoplasma pneu...
P47669       303 AFPPQTIKNSLGEVIANNNLKQLRIAETEKYAHVTFFFDGGFEVNLSNETKTLIPSLKVATYDLAPEMSCKAITDALLEK 382 Mycoplasma geni...
WP_003114478 308 AFPPEPLTNVLGEYLAKHGKTQLRIAETEKYAHVTFFFSGGREEPYEGEERILIPSPKVATYDLQPEMSAPEVTDRIVEA 387 Pseudomonas aer...
WP_010903383 302 AFPAAEPTDTLGAVLAAHDHTQLRVAESEKYAHVTYFLNGGREVAFDGETRTIVDSPDVPTYDEQPAMSAPAVTDTVLDA 381 Halobacterium s...
P56196       371 MKLG-TDLIIVNFANGDMVGHTGNFEASVKAVEAVDACLGEILSLAKKLDYAMLLTSDHGNCERMKDEN-Q-NPLTNHTA 447 Helicobacter py...
P37689       387 IKSGkYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPA-TgQAHTAHTN 465 Escherichia col...
P74507       382 MEKGiYSLVVVNYANPDMVGHTGKLKEAIQAIETVDLNLGRLLASAAKVGGTVLITADHGNAEYMSDES-G-NPWTAHTT 459 Synechocystis s...
BAB12237     392 IAEGkFEFVMNNFAPPDMVGHTGKYEAAIQGVAATDKAIGVIYEACKKQGYVLFITADHGNAEEMLTEK-G-TPKTSHTT 469 Aspergillus oryzae
P75167       383 INQ--FDLTVLNFANPDMVGHTGNYAACVQGLEALDVQIQRIIDFCKANHITLFLTADHGNAEEMIDSN-N-NPVTKHTV 458 Mycoplasma pneu...
P47669       383 LNN--FDFTVLNFANPDMVGHTGNYQACIKALEALDVQIKRIVDFCKANQITMFLTADHGNAEVMIDNN-N-NPVTKHTI 458 Mycoplasma geni...
WP_003114478 388 IEQQrYDVIVVNYANGDMVGHTGVFEAAVKAVECLDTCMGRIVEALDKVGGEALITADHGNVEQMEDEStG-QAHTAHTC 466 Pseudomonas aer...
WP_010903383 382 LAGDdPDVLVLNYANPDMVGHTGDFDAAIEAVEAVDRELGRLVPALNDAGAHAFLTADHGNADDLGTPA-D--PHTAHTF 458 Halobacterium s...
P56196       448 GSVYCFVLG-------DGv--K--SIkNGA-LNNIASSVLKLMGLKAPATMD-EPLF 491 Helicobacter pylori 26695
P37689       466 LPVPLIYVGd------KNv--K--AV-EGGkLSDIAPTMLSLMGMEIPQEMTgKPLF 511 Escherichia coli K-12
P74507       460 NPVPFILVEgegrkipGHggeV--KLrEGGkLADIAPTILDILQLPVPAEMTgKTLI 514 Synechocystis sp. PCC 6803 substr. Kazusa
BAB12237     470 NKVPFIMANa-----pEGw--S--LKkEGGvLGDVAPTVLAAMGIEQPEEMSgQNLL 517 Aspergillus oryzae
P75167       459 NKVPFVCTD-------TNi--D--LQqDSAsLANIAPTILAYLGLKQPAEMTaNSLL 504 Mycoplasma pneumoniae M129
P47669       459 NPVPFVCTD-------KNv--N--FNq-TGiLANIAPTILEYLNLSKPKEMTaKSLL 503 Mycoplasma genitalium G37
WP_003114478 467 EPVPFVYVGk------RK---L--SIrEGGvLADVAPTMLTLMGLEQPAEMTgRSIV 512 Pseudomonas aeruginosa
WP_010903383 459 NPVPFVSLPp------ASg--DtaAVrDGGaLRDIAPTLLDVLGIDRPTVMTgASLL 507 Halobacterium salinarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap