1YPF


Conserved Protein Domain Family
GMP_reduct_2

?
TIGR01306: GMP_reduct_2 
Click on image for an interactive view with Cn3D
guanosine monophosphate reductase, bacterial
A deep split separates two families of GMP reductase. The other (TIGR01305) is found in eukaryotic and some proteobacterial lineages, including E. coli, while this family is found in a variety of bacterial lineages. [Purines, pyrimidines, nucleosides, and nucleotides, Nucleotide and nucleoside interconversions]
Statistics
?
PSSM-Id: 130373
View PSSM: TIGR01306
Aligned: 4 rows
Threshold Bit Score: 643.147
Threshold Setting Gi: 499224759
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YPF_A        13 VFDYEDIQLIPAKCIVNSRSECDTTVTLGKHKFKLPVVPANMQTIIDERIATYLAENNYFYIMHRFQPEKRISFIRDMQS 92  Bacillus anthracis
CAB07955       4 VFDYEDIQLIPAKCIVNSRSECDTSVRLGGHTFKLPVVPANMQTIIDEKLAISLAENGYFYVMHRFEPETRIDFIKDMNA 83  Bacillus subtil...
WP_010922299   7 VFDYEDIQLIPNKCIITSRSQADTSVTLGKYQFKLPVIPANMQTIIDETIAEQLAKEGYFYIMHRFDEDSRKPFIKRMHE 86  Streptococcus p...
WP_031920029   3 IFDYEDIQLIPNKCIVESRSECDTTIQFGPKKFKLPVVPANMQTVMNEKLAKWFAENDYFYIMHRFDEEARIPFIKHMQN 82  Staphylococcus ...
1YPF_A        93 RGLIASISVGVKEDEYEFVQQLAAEHLTPEYITIDIAHGHSNAVINMIQHIKKHLPESFVIAGNVGTPEAVRELENAGAD 172 Bacillus anthracis
CAB07955      84 RGLFSSISVGVKDEEYEFVRQLAEENLTPEYVTIDIAHGHSNAVIEMIQHLKKHLPDSFVIAGNVGTPEAVRELENAGAD 163 Bacillus subtil...
WP_010922299  87 QGLIASISVGVKACEYEFVTSLKEDA--PEFITIDIAHGHANSVIDMIKHIKTELPETFVIAGNVGTPEAVRELENAGAD 164 Streptococcus p...
WP_031920029  83 SGLFASISVGVKKAEFDFIEKLAQEKLIPEYITIDIAHGHSDSVINMIKHIKTHIPDSFVIAGNVGTPEGVRELENAGAD 162 Staphylococcus ...
1YPF_A       173 ATKVGIGPGKVCITKIKTGFGTGGWQLAALRWCAKAASKPIIADGGIRTNGDVAKSIRFGATMVMIGSLFAGHEESPGET 252 Bacillus anthracis
CAB07955     164 ATKVGIGPGKVCITKIKTGFGTGGWQLAALRWCAKAASKPIIADGGIRTHGDIAKSIRFGATMVMIGSLFAGHEESPGQT 243 Bacillus subtil...
WP_010922299 165 ATKVGIGPGKVCITKVKTGFGTGGWQLAALRWCAKAARKPIIADGGIRTHGDIAKSIRFGASMVMIGSLFAGHFESPGKT 244 Streptococcus p...
WP_031920029 163 ATKVGIGPGRVCITKIKTGFGTGGWQLAALNICSKAARKPLIADGGIRTHGDIAKSIRFGASMVMIGSLFAAHEESPGET 242 Staphylococcus ...
1YPF_A       253 IEKDGKLYKEYFGSASEFQKGEKKNVEGKKMFVEHKGSLEDTLIEMEQDLQSSISYAGGTKLDSIRTVDYVVVKNSIFNG 332 Bacillus anthracis
CAB07955     244 IEKDGKLYKEYFGSASEFPKGEKKNVEGKKMHVAHKGSIKDTLIEMEQDLQSSISYAGGTKLNAIRNVDYVIVKNSIFNG 323 Bacillus subtil...
WP_010922299 245 VEVDGETFKEYYGSASEYQKGEHKNVEGKKILLPTKGHLSDTLTEMQQDLQSSISYAGGKDLDSLRHVDYVIVKNSIWNG 324 Streptococcus p...
WP_031920029 243 VELDGKQYKEYFGSASEFQKGEHKNVEGKKMFVEHKGSLMDTLKEMQQDLQSSISYAGGKDLKSLRTVDYVIVRNSIFNG 322 Staphylococcus ...
1YPF_A       333 D 333 Bacillus anthracis
CAB07955     324 D 324 Bacillus subtilis subsp. subtilis str. 168
WP_010922299 325 D 325 Streptococcus pyogenes
WP_031920029 323 D 323 Staphylococcus aureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap