2BLE


Conserved Protein Domain Family
GMP_reduct_1

?
TIGR01305: GMP_reduct_1 
Click on image for an interactive view with Cn3D
guanosine monophosphate reductase, eukaryotic
A deep split separates two families of GMP reductase. This family includes both eukaryotic and some proteobacterial sequences, while the other family contains other bacterial sequences. [Purines, pyrimidines, nucleosides, and nucleotides, Nucleotide and nucleoside interconversions]
Statistics
?
PSSM-Id: 130372
View PSSM: TIGR01305
Aligned: 4 rows
Threshold Bit Score: 682.802
Threshold Setting Gi: 42616
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BLE_A    25 RIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSL 104 human
P36959     3 RIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSL 82  human
CAA30751   2 RIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQSWSGVPIIAANMDTVGTFSMASALASFDILTAVHKHYSV 81  Escherichia coli
O16294     3 RIENEPKLDFKDVLLRPKRSTLKSRADVELDREYVFRNSKATYTGVPVVASNMDTVGTFEMAAALNNHKIFTTIHKHYSV 82  Caenorhabditis elegans
2BLE_A   105 DDWKLFATn-HPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVT 183 human
P36959    83 DDWKLFATn-HPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVT 161 human
CAA30751  82 EEWQAFINnsSADVLKHVMVSTGTSDADFEKTKQILDLNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVT 161 Escherichia coli
O16294    83 DEWKAFAAsaSPDTFNNLAISSGISDNDWTKLNTVITELPQLKYICLDVANGYSESFVEFIRRVREAYPKHTIMAGNVVT 162 Caenorhabditis elegans
2BLE_A   184 GEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVML 263 human
P36959   162 GEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVML 241 human
CAA30751 162 GEMCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVSDGGCTTPGDVAKAFAR-ADFVML 240 Escherichia coli
O16294   163 GEMVEELILSGADIVKVGIGPGSVCTTRKKAGVGYPQLSAVLECADAAHGLNGHVMSDGGCSNPGDVAKAFGAGADFVMI 242 Caenorhabditis elegans
2BLE_A   264 GGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGA 343 human
P36959   242 GGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGA 321 human
CAA30751 241 GGMLAGHEESGGRIVEENGEKFMLFYGMSSESAMKRHVGGVAEYRAAEGKTVKLPLRGPVENTARDILGGLRSACTYVGA 320 Escherichia coli
O16294   243 GGLFAGHDQSGGDLIEHNGKKFKLFYGMSSDTAMKKHHGSVAEYRASEGKTVTIPYRGDVNGTVQDILGGIRSACTYTGA 322 Caenorhabditis elegans
2BLE_A   344 AKLKELSRRATFIRVTQQHNTVF 366 human
P36959   322 AKLKELSRRATFIRVTQQHNTVF 344 human
CAA30751 321 SRLKELTKRTTFIRVQEQENRIF 343 Escherichia coli
O16294   323 KHLKELAKRATFIRVTQQTNDMY 345 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap