Conserved Protein Domain Family
IMP_DH_rel_1

?
TIGR01303: IMP_DH_rel_1 
IMP dehydrogenase family protein
This model represents a family of proteins, often annotated as a putative IMP dehydrogenase, related to IMP dehydrogenase and GMP reductase and restricted to the high GC Gram-positive bacteria. All species in which a member is found so far (Corynebacterium glutamicum, Mycobacterium tuberculosis, Streptomyces coelicolor, etc.) also have IMP dehydrogenase as described by TIGRFAMs entry TIGR01302. [Unknown function, General]
Statistics
?
PSSM-Id: 130370
View PSSM: TIGR01303
Aligned: 3 rows
Threshold Bit Score: 853.818
Threshold Setting Gi: 489999192
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB76883       5 RFLNDIQPSYDLTYDDVFMVPSRSAVGSRQGVDLGSPDGTGTTIPLVVANMTAIAGRRMAETVARRGGLVVIPQDIPIEV 84  Streptomyces co...
CAC25574       2 RFLNNSNPPYELTYSDVFMVPSRSDVGSRMSVDLRTNDGTGTTIPLVVANMTAVAGRRMAETIARRGGMAILPQDVPADI 81  Corynebacterium...
WP_003902189   3 RFLDGHPPGYDLTYNDVFIVPNRSEVASRFDVDLSTADGSGTTIPVVVANMTAVAGRRMAETVARRGGIVILPQDLPIPA 82  Mycobacterium t...
CAB76883      85 VTDVVSWVKSRHHVLDTPIVLAPHQTVADALALLPKRAHNAGVVVDEDgKPVGVVTDTDLNGVDRFTQLEEVMSKDLILI 164 Streptomyces co...
CAC25574      82 AAETIANVKKADLVFDTPITVKPHHTVGYARNLIHKRAHGAAIVLEGD-QPVGIVTDKDLEGADNFTQVGTLMSTSLLTL 160 Corynebacterium...
WP_003902189  83 VKQTVAFVKSRDLVLDTPVTLAPDDSVSDAMALIHKRAHGVAVVILEG-RPIGLVRESSCLGVDRFTRVRDIAVTDYVTA 161 Mycobacterium t...
CAB76883     165 DADLDPREAFNTLDAANRRYAPAVDKDGRLAGILTRKGALRATLYTPAVDAQGRLRIAAAVGINGDVAGKAKQLLDAGVD 244 Streptomyces co...
CAC25574     161 PEDISPEDAFGILHEHSRKLAPVVAADGSLRGILTRTGALRATMYKPAIDANGRLRVGAAIGINGDIEGRTKTLLDAGAD 240 Corynebacterium...
WP_003902189 162 PAGTEPRKIFDLLEHAPVDVAVLTDADGTLAGVLSRTGAIRAGIYTPATDSAGRLRIGAAVGINGDVGAKARALAEAGVD 241 Mycobacterium t...
CAB76883     245 TLVIDTAHGHQESMISAVKVVRDLDPRVPIVAGNIVSAQGVRDLIEAGADIIKVGVGPGAMCTTRMMTGVGRPQFSAVLE 324 Streptomyces co...
CAC25574     241 VLVVDTAHGHQSTMISALKRIRALDVNVPIVAGNVVTADGVRDLVEAGANIIKVGVGPGAMCTTRMQTGVGRPQFSAVLE 320 Corynebacterium...
WP_003902189 242 VLVIDTAHGHQVKTLDAIKAVSALDLGLPLAAGNVVSAEGTRDLLKAGANVVKVGVGPGAMCTTRMMTGVGRPQFSAVLE 321 Mycobacterium t...
CAB76883     325 CAAEAKKYGKHVWADGGVRHPRDVAMALAAGASNVMVGSWFAGTYESPGDLQHDANGRAYKESFGMASARAVRNRTSEES 404 Streptomyces co...
CAC25574     321 CAAEARKLGAHVWADGGVRDPRDVALALAAGASNVMVGSWFSGTYESPGDLRFESDGRMYKESFGMASRRAVESRNQKVE 400 Corynebacterium...
WP_003902189 322 CASAARQLGGHIWADGGIRHPRDVALALAAGASNVMIGSWFAGTYESPGDLMRDRDDQPYKESYGMASKRAVVARTGADN 401 Mycobacterium t...
CAB76883     405 AYDRARKALFEEGISTSRMFLDPARPGVEDLIDAIIAGVRSSCTYAGAGSLEEFTEKAIVGIQSAAGYAEGKPLHA 480 Streptomyces coelic...
CAC25574     401 AFEKARRAMFEEGISTARIYIDKRHGGVEDLVDQIISGVRSSFTYAGADSIETFFERATVGVQSTEGYAEGKPRAS 476 Corynebacterium glu...
WP_003902189 402 PFDRARKALFEEGISTSRMGLDPDRGGVEDLIDHITSGVRSTCTYVGASNLAELHERAVVGVQSGAGFAEGHPLPA 477 Mycobacterium tuber...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap