Conserved Protein Domain Family
synapt_SV2

?
TIGR01299: synapt_SV2 
synaptic vesicle protein SV2
This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.
Statistics
?
PSSM-Id: 130366
View PSSM: TIGR01299
Aligned: 2 rows
Threshold Bit Score: 1409.34
Threshold Setting Gi: 148747227
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC78628    1 MEDSYKDRTSLMKGAKDIAKEVKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEDDDDDYYPPGETYS-GEANDD----EGS 75  Norway rat
NP_476558   1 MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEEDDDDFPAPADGYYrGEGAQDeeegGAS 80  Norway rat
AAC78628   76 SEATEGHDEEDEIYEGEYQGIP-STNQGKDSIVSVGQPKG---DEYKDRR-----ELESERRADEEELAQQYELIIQECG 146 Norway rat
NP_476558  81 SDATEGHDEDDEIYEGEYQGIPrAESGGKGERMADGAPLAgvrGGLSDGEgppggRGEAQRRKDREELAQQYETILRECG 160 Norway rat
AAC78628  147 HGRFQWALFFVLGMALMADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMS 226 Norway rat
NP_476558 161 HGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS 240 Norway rat
AAC78628  227 VNGFFAFLSSFVQGYGFFLLCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIPHYGW 306 Norway rat
NP_476558 241 VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGW 320 Norway rat
AAC78628  307 SFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEVGKHDEAWMILKLIHDTNMRARGQPEKVFTVNKIKTP 386 Norway rat
NP_476558 321 SFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTI 400 Norway rat
AAC78628  387 KQIDELIEIESDTGTWYRRCFVRIRTELYGIWLTFMRCFNYPVRENTIKLTIVWFTLSFGYYGLSVWFPDVIKHLQSDEY 466 Norway rat
NP_476558 401 HQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFSPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY 480 Norway rat
AAC78628  467 ALLTRNVQKDKYANFSINFTMENQVHTGMEYDNGRFLGVKFKSVTFKDSVFKSCTFDDVTSVNTYFKNCTFIDTLFENTD 546 Norway rat
NP_476558 481 AARTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTD 560 Norway rat
AAC78628  547 FEPYKFIDSEFQNCSFLHNKTGCQITFD-DDYSAYWIYFVNFLGTLAVLPGNIVSALLMDRIGRLTMLGGSMVLSGISCF 625 Norway rat
NP_476558 561 LFEYKFVNSRLVNSTFLHNKEGCPLDVTgTGEGAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVLSCVSCF 640 Norway rat
AAC78628  626 FLWFGTSESMMIGMLCLYNGLTISAWNSLDVVTVELYPTDRRATGFGFLNALCKAAAVLGNLIFGSLVSITKAIPILLAS 705 Norway rat
NP_476558 641 FLSFGNSESAMIALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS 720 Norway rat
AAC78628  706 TVLVCGGLVGLRLPDTRTQVLM 727 Norway rat
NP_476558 721 AALALGSSLALKLPETRGQVLQ 742 Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap