Conserved Protein Domain Family
nodJ

?
TIGR01291: nodJ 
ABC-2 type transporter, NodJ family
Nearly all members of this subfamily are NodJ which, together with NodI (TIGR01288), acts to export a variety of modified carbohydrate molecules as signals to plant hosts to establish root nodules. The seed alignment includes a highly divergent member from Azorhizobium caulinodans that is, nonetheless, associated with nodulation. This model is designated as subfamily in part because not all sequences derived from the last common ancestral sequence of Rhizobium sp. and Azorhizobium caulinodans NodJ are necessarily nodulation proteins. [Cellular processes, Other, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130358
View PSSM: TIGR01291
Aligned: 3 rows
Threshold Bit Score: 377.309
Threshold Setting Gi: 585571
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O52619  10 PANGWNWIAVWRRNYLAWKKVALASILGNLADPLIYLFGLGAGLGMMVGRVDGVSYIAFLSAGMVATSAMTASTFETIYA 89  Sinorhizobium melilot...
P50333  10 PSGLLNWVAVWRRNFLAWKKVAPASLLGNLADPMIYIFGLGSGLGVMLGNVGGVSYSAFLAAGMVATSAMTASTFETIYA 89  Neorhizobium galegae
Q07757   2 RERMVTWAAVFQRNAMSWRREMAASVLGSVIDPLIMLFGLGVGLGKIVDSVDGRSYAEFLACGLILTSAMSASNYEMLYG 81  Azorhizobium caulinod...
O52619  90 TFARMRAQRTWEAILHTQVTIGDIVLGELAWAATKASLAGTGIGVVAATLGYTEWVSLLYALPVIALTGLAFASLAMIVT 169 Sinorhizobium melilot...
P50333  90 TFARMRDHRTWEAMLYTKLTLGDIVLGEMAWAATKASLAGTAIGIVTATLAYSEWDSLIYVFPVIALTGLAFASLSMVVA 169 Neorhizobium galegae
Q07757  82 TYSRIYVTGTLKSMRYAPICVSDYLIGEVLWAAYEGVVAGTIVAVCTAFLGYIPGWSVIYILPDILFVALIFSSTSLLVA 161 Azorhizobium caulinod...
O52619 170 ALAPSYEYFIFYQTLVITPMLFLSGAVFPVNQLPGAFQHVTRILPLAHSIDVIRPIMLGSPLVHVGLHIGALCCYAVVPF 249 Sinorhizobium melilot...
P50333 170 ALAPSYDYLVFYQSLVITPMLVLSGSVFPVEQLSPMLQRITHLLPLAHSIDLIRPAMLGHPVPDITLHLGALCLYIVLPF 249 Neorhizobium galegae
Q07757 162 AISRGYALFAFYQSIAIAPLVFLSGVIVPRFTGNDVISGMIHFSPLYRAVNDVRNVVYEGRGTQVGPLLLLSLLYASVMV 241 Azorhizobium caulinod...
O52619 250 FLSTALLRRRLMP 262 Sinorhizobium meliloti 1021
P50333 250 FVSIALLRRRLTQ 262 Neorhizobium galegae
Q07757 242 FISAKVICVRLDD 254 Azorhizobium caulinodans ORS 571
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap