Conserved Protein Domain Family
nodI

?
TIGR01288: nodI 
ATP-binding ABC transporter family nodulation protein NodI
This protein is required for normal nodulation by nitrogen-fixing root nodule bacteria such as Mesorhizobium loti. It is a member of the family of ABC transporter ATP binding proteins and works with NodJ to export a nodulation signal molecule. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans. [Cellular processes, Other, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130355
View PSSM: TIGR01288
Aligned: 3 rows
Threshold Bit Score: 611.164
Threshold Setting Gi: 128473
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P55476    41 SDVAIELTNVSKSYGDKVVVDQLSFTITSGECFGLLGPNGAGKSTVSRLVLGLAPPDEGTITVLGEPVPARARLARSRIG 120 Sinorhizobium fredi...
P08720     9 SPVAIDLAGVSKSYGGKIVVNDLSFTIAAGECFGLLGPNGAGKSTITRMILGMTSPSVGKITVLGAQEPGQVRLARAKIG 88  Rhizobium leguminos...
AAA26229   4 SNMAIDLVGVRKSFGDKVIVNDLSFSVARGECFGLLGPNGAGKSTIARMLLGMISPDRGKITVLDEPVPSRARAARVAVG 83  Bradyrhizobium japo...
P55476   121 VVPQFDTLDREFTARENLLVFGRYFGLHTRELEEAIPPLLDFARLESKADVPVAQLSGGMQRRLTLACALINDPQLLILD 200 Sinorhizobium fredi...
P08720    89 IVSQFDNLDLEFTVRENLLVYGRYFRMSTREIETVIPSLLEFARLESKANTRVADLSGGMKRRLTLAGALINDPQLLILD 168 Rhizobium leguminos...
AAA26229  84 VVPQFDNLEPEFTVRENLLVFGRYFGMSARTIEAVVPSLLEFARLESKADVRVSLLSGGMKRRLTLARALINDPHLLVMD 163 Bradyrhizobium japo...
P55476   201 EPTTGLDPHARHLIWERLRSLLALGKTILLTTHFMEEADRLCDRLCVIEHGRKIVEGRPHALIDEQIGCDVIEIYGGNPR 280 Sinorhizobium fredi...
P08720   169 EPTTGLDPHARHLIWERLRSLLARGKTILLTTHIMEEAERLCDRLCVLEAGRKIAEGRPHALIEEQIGCPVIEIYGGDPQ 248 Rhizobium leguminos...
AAA26229 164 EPTTGLDPHARHLIWERLRALLARGKTILLTTHFMEEAERLCDRLCVLESGCKIAEGKPDALIDEHIGCNVIEIYGGDLD 243 Bradyrhizobium japo...
P55476   281 ELTSVVGPYAQRVEVSGETLFCYSSDPEQVRLQLRGRTGLRLLQRPPNLEDVFLRLTGREMKD 343 Sinorhizobium fredii NGR234
P08720   249 ELSLLIRPNARRLEISGETLFCYTPDPEQVRAQLRAYSNLRLLERPPNLEDVFLRLTGREMEK 311 Rhizobium leguminosarum bv. viciae
AAA26229 244 QLRELIRPYARHIEVSGETLFCYARCPDEISVHLRGRTDLRVLQRPPNLEDVFLRLTGREMEK 306 Bradyrhizobium japonicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap