3MIN


Conserved Protein Domain Family
nifK

?
TIGR01286: nifK 
Click on image for an interactive view with Cn3D
nitrogenase molybdenum-iron protein beta chain
This model represents the majority of known sequences of the nitrogenase molybdenum-iron protein beta subunit. A distinct clade in a phylogenetic tree contains molybdenum-iron, vanadium-iron, and iron-iron forms of nitrogenase beta subunit and is excluded from this model. Nitrogenase, also called dinitrogenase, is responsible for nitrogen fixation. Note: the trusted cutoff score has recently been lowered to include an additional family in which the beta subunit is shorter by about 50 amino acids at the N-terminus. In species with the shorter form of the beta subunit, the alpha subunit has a novel insert of similar length. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 130353
View PSSM: TIGR01286
Aligned: 5 rows
Threshold Bit Score: 956.988
Threshold Setting Gi: 2499200
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3MIN_B         1 SQQVDKIKASYPLFLDQDYKDMLAKKrDGFEEKYPQDKIDEVFQWTTTKEYQELNFQREALTVNPAKACQPLGAVLCALG 80  Azotobacter vin...
Q57118         9 SAVPLRVLDHNDIFRDEVYQKQFEGK-REFENAAPKEEVQRVLDWTRGWEYREKNFAREALTVNPAKACQPLGAVLAALG 87  Frankia alni
O07643         2 AQNVNNIKDHVDLFHQPEYQELFENK-KQFEGMPTAEKVQEVAEWTKSWEYREKNFAREALTVNPAKACQPLGALLAAIG 80  Cyanothece sp. ...
WP_010913610   2 PQSAEKVLDHAPLFREPEYRQMLAEKkLNFECPHPDQIVTDQRELTKTWEYREKNLAREALVINPAKACQPLGAVFAAAG 81  Mesorhizobium loti
AAA64711       2 SQQVDKIKASYPLFLDQDYKDMLAKKrDGFEEKYPQDKIDEVFQWTTTKEYQELNFQREALTVNPAKACQPLGAVLCALG 81  Azotobacter vin...
3MIN_B        81 FEKTMPYVHGSQGCVAYFRSYFNRHFREPVSCVSDSMTEDAAVFGGQQNMKDGLQNCKATYKPDMIAVSTTCMAEVIGDD 160 Azotobacter vin...
Q57118        88 FEGTMPLVHGSQGCVAYFRSHFARHFKEPVPAASTSMTEDAAVFGGINNLVEAMENITALYKPKHIAVSTTCMAEVIGED 167 Frankia alni
O07643        81 FEGTLPFVHGSQGCVAYFRTHLTRHFKEPVSAVSSSMTENAAVFGGLKNMVDGLQNSYALYKPKMIAVCTTCMAEVIGDD 160 Cyanothece sp. ...
WP_010913610  82 FERTMSFVHGSQGCVAYYRSHLSRHFKEPSSAVSSSMTEDAAVFGGLKNMVDGLANTYKLYDPKMIAVSTTCMAEVIGDD 161 Mesorhizobium loti
AAA64711      82 FEKTMPYVHGSQGCVAYFRSYFNRHFREPVSCVSDSMTEDAAVFGGQQNMKDGLQNCKATYKPDMIAVSTTCMAEVIGDD 161 Azotobacter vin...
3MIN_B       161 LNAFINNSKKEGFIPDEFPVPFAHTPSFVGSHVTGWDNMFEGIARYFTLKSMD---DKVVGSNKKINIVPGFETY-LGNF 236 Azotobacter vin...
Q57118       168 LFAYIGAAREQEAITQDFPVSYAHTPCFVGSHITGYDVMLKGILEMLAKSPDAdasKVAKSDKVRLNVIPGFDTY-IGNH 246 Frankia alni
O07643       161 LGAFLGNARQDGVIPDDLPVPFAHTPSFVGSHITGYDSMMKSILSTLTEGKK------KETTNGKINFIAGFETY-IGNV 233 Cyanothece sp. ...
WP_010913610 162 LRSFIENAKNEGSVPSDFDVPFAHTPAFVGSHIDGYDGMVKGVLEHFWKGSE------RSQAAGTINIIPGFDGFcVGNN 235 Mesorhizobium loti
AAA64711     162 LNAFINNSKKEGFIPDEFPVPFAHTPSFVGSHVTGWDNMFEGIARYFTLKSMD---DKVVGSNKKINIVPGFETY-LGNF 237 Azotobacter vin...
3MIN_B       237 RVIKRMLSEMGVGYSLLSDPEEVLDTPADGQFRMYAGGTTQEEMKDAPNALNTVLLQPWHLEKTKKFVEGTWKHEVPKLN 316 Azotobacter vin...
Q57118       247 REYKRILELMGVDPLILGDHSSSLDSPADGEYDLYPGGTPLAEGALAKFSRASLVLQESTLRRTAEYIEKDWKQETVLLE 326 Frankia alni
O07643       234 RAIKNIISAFDLEGTLLSDTEMYLDSPNLGEFKMYHEGTSLEDAADSINAEATVTLQTYTTPKTREYIEKKWGQKTYTYR 313 Cyanothece sp. ...
WP_010913610 236 RELKRLLDLMGVTYTVIQDASDQFDTPSDGEYRMYDGGTKIEDLKGALNAEATLSLQHYNTRKTLEYCDEVGQA-TASFH 314 Mesorhizobium loti
AAA64711     238 RVIKRMLSEMGVGYSLLSDPEEVLDTPADGQFRMYAGGTTQEEMKDAPNALNTVLLQPWHLEKTKKFVEGTWKHEVPKLN 317 Azotobacter vin...
3MIN_B       317 IPMGLDWTDEFLMKVSEISGQPIPASLTKERGRLVDMMTDSHTWLHGKRFALWGDPDFVMGLVKFLLELGCEPVHILCHN 396 Azotobacter vin...
Q57118       327 TPLGVKGTDAFLTAVAKVAEVEVPAELTAERGRLVDAITDSHAYVHGKRVAIAGDPDLVIALTRFVLELGMIPVHIVSTN 406 Frankia alni
O07643       314 -PWGVKGTDEFLMGLSELTGKPIPKEFEIARGRAVDAMTDTQAWVHGKRAAVYGDPDLVMGLLQFMLEMGIEPVHVLVNN 392 Cyanothece sp. ...
WP_010913610 315 YPLGVQATDEFLMKVSAISGQEIPEAIRMERGRLVDAMADSQSWLHGKKYAIYGDPDFVYATARFVMETGGEPTHCLATN 394 Mesorhizobium loti
AAA64711     318 IPMGLDWTDEFLMKVSEISGQPIPASLTKERGRLVDMMTDSHTWLHGKRFALWGDPDFVMGLVKFLLELGCEPVHILCHN 397 Azotobacter vin...
3MIN_B       397 GNKRWKKAVDAILAASPYGKNATVYIGKDLWHLRSLVFTDKPDFMIGNSYGKFIQRDTLhkgkefeVPLIRIGFPIFDRH 476 Azotobacter vin...
Q57118       407 ADTTFKARMEKVLSASKFGEEATVWPEKDLWHLRSLVFTEPVDLLIGSMQLKYISREAN-------VPLVRVGFPIFDRH 479 Frankia alni
O07643       393 STKEFEEEAKALLAASPYGQQATVWGGKDLWHMRSLLFTEPVDFLVGNSYAKYLQRDTk-------TPLIRIGYPIFDRH 465 Cyanothece sp. ...
WP_010913610 395 GTSAWEAEMKELLASSSFGQDAQIWAGKDLWAMRSLLFTEPVDLLIGNSYGKYLERDTg-------TPLIRLMFPIFDRH 467 Mesorhizobium loti
AAA64711     398 GNKRWKKAVDAILAASPYGKNATVYIGKDLWHLRSLVFTDKPDFMIGNSYGKFIQRDTLhkgkefeVPLIRIGFPIFDRH 477 Azotobacter vin...
3MIN_B       477 HLHRSTTLGYEGAMQILTTLVNSILERLDEEtrgmqATDYNHDLVR 522 Azotobacter vinelandii
Q57118       480 HLHRFPIIGYTGGLHLLTQLVNTILDEMDRN-----DPDHSFELRR 520 Frankia alni
O07643       466 HLHRYSTIGYEGAINLLNWIANGLMDELDRKtdtpsVTDISFDLVR 511 Cyanothece sp. ATCC 51142
WP_010913610 468 HHHRFPLMGYQGGLRVLTTILDKIFDKLDREtsetgVTDYSYDLTR 513 Mesorhizobium loti
AAA64711     478 HLHRSTTLGYEGAMQILTTLVNSILERLDEEtrgmqATDYNHDLVR 523 Azotobacter vinelandii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap