1G20,1MIO


Conserved Protein Domain Family
nifD

?
TIGR01282: nifD 
Click on image for an interactive view with Cn3D
nitrogenase molybdenum-iron protein alpha chain
Nitrogenase consists of alpha (NifD) and beta (NifK) subunits of the molybdenum-iron protein and an ATP-binding iron-sulfur protein (NifH). This model describes a large clade of NifD proteins, but excludes a lineage that contains putative NifD and NifD homologs from species with vanadium-dependent nitrogenases. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 162284
View PSSM: TIGR01282
Aligned: 17 rows
Threshold Bit Score: 768.452
Threshold Setting Gi: 580995
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1G20_A        12 LIQEVLEVYPEKARKDRNKHLAVNd--PaVt-QSK-----KcIISNKKSQPGLMTIRGCAYAGSKGVVWGPIKDMIHISH 83  Azotobacter vin...
P19066        15 LITQVLSQYPHKAAKRRQKHLSVAsdrEaVg-EEGetlseCdVKSNIKSIPGVMTIRGCAYAGSKGVVWGPVKDMVHISH 93  Sinorhizobium f...
CAA25523      19 LIEEVLKVYPEKTAKRRAKHLNVH---Q-Ag-KSD-----CgVKSNIKSIPGVMTIRGCAYAGSKGVVWGPIKDMVHISH 88  Bradyrhizobium ...
P77874        15 LINEVLKAYPDKTAKRRAKHLTTQ---E-Eg-KSD-----CnVKSNIKSIPGVMTIPPCAYAGSKGVVWGPIKDMIHISH 84  Herbaspirillum ...
P25313        14 LVDKVLEAYPEKSRRRRAKHLNVL---E-Ae-AKD-----CgVKSNIKSIPGVMTIRGCAYAGSKGVVWGPIKDMIHISH 83  Azospirillum br...
P00466        13 LIQEVLEVFPETARKERRKHMMVSd--PkMk-SVG-----KcIISNRKSQPGVMTVRGCAYAGSKGVVFGPIKDMAHISH 84  Klebsiella pneu...
AAA96263      15 MIAEVLSQYPKKAAKFRAKHLKAN---DpEg-SKE-----CeVKSNIKSRPGVMTIRGCAYAGSKGVVWGPVKDMVTISH 85  Frankia alni
CAA68349       5 LKDEILEKYIPKTKKTRSGHIVIK---TeEt-PNP-----E-IVANTRTVPGIITARGCAYAGCKGVVMGPIKDMVHITH 74  Clostridium pas...
WP_011712867  12 LIEEVLEVYPEESKKDRLKHLTVN---DpSitQSK-----KcITSNRKSLPGVMTIRGCAYAGSKGVVWGPIKDMIHISH 83  Magnetococcus m...
WP_010933201  13 IKEELINKYPAKVAKKRSKSIVVN---DpEi-VPE-------VQANVRTVPGIITQRGCAYAGCKGVVLGPTRDIVNIVH 81  Chlorobaculum t...
1G20_A        84 GPVGCGQYSRAGRRNYYIGTTG-VNAFVTMNFTSDFQEKDIVFGGDKKLAKLIDEVETLFPLnKGISVQSECPIGLIGDD 162 Azotobacter vin...
P19066        94 GPVGCGQYSWSQRRNYYVGTTG-VDTFVTMQFTSDFQEKDIVFGGDKKLEQVIDEIEELFPLnNGITIQSECPIGLIGDD 172 Sinorhizobium f...
CAA25523      89 GPVGCGQYSWGSRRNYYVGTTG-IDSFVTLQFTSDFQEKDIVFGGDKKLDKILDEIQELFPLnNGITIQSECPVGLIGDD 167 Bradyrhizobium ...
P77874        85 GPVGCGQYSWGSRRNYYIGKTG-IDSFVTMQFTSDFQEKDIVFGGDKKLEKIVDEIQELFPLnKGISVQSECPIGLIGDD 163 Herbaspirillum ...
P25313        84 GPVGCGYYSWSGRRNYYVGDTG-VDKLGTMHFTSDFQEKDIVFGGDKKLHKVIEEINELFPLvNGISIQSECPIGLNGDD 162 Azospirillum br...
P00466        85 GPAGCGQYSRAERRNYYTGVSG-VDSFGTLNFTSDFQERDIVFGGDKKLSKLIEEMELLFPLtKGITIQSECPVGLIGDD 163 Klebsiella pneu...
AAA96263      86 GPVGCGQYSWATRRNYAHGHLG-VDNFTAMQITTDFQEKDIVFGGDPKLEQVCDEIVELFPLaKGISVQSECPIGLIGDD 164 Frankia alni
CAA68349      75 GPIGCSFYTWGGRRFKSKPENGtGLNFNEYVFSTDMQESDIVFGGVNKLKDAIHEAYEMFHP-AAIGVYATCPVGLIGDD 153 Clostridium pas...
WP_011712867  84 GPVGCGQYSRAGRRNYYVGYTG-VNAFGTMNFTSDFQERDVVFGGDKKLEKIVHECEALFPLmKGMSVQSECPIGLIGDD 162 Magnetococcus m...
WP_010933201  82 GPIGCSFYAWLTRRNQTRPETPeHENYITYCFSTDMQEEHVVFGGEKKLKVAIQEAYDLFHP-KAIAIFSTCPVGLIGDD 160 Chlorobaculum t...
1G20_A       163 IESVSKVKGAELS-KTIVPVRCEGFRGVSQSLGHHIANDAVRDWVLGKRDe--dTTfASTPYDVAIIGDYNIGGDAWSSR 239 Azotobacter vin...
P19066       173 IEAVSRKKAAEHE-TTIVPVRCEGFRGVSQSLGHHIANDAIRDWVFDKADgktdVEfETGPYDVNVIGDYNIGGDAWASR 251 Sinorhizobium f...
CAA25523     168 IEAVSRAKSKEYGgKTIVPVRCEGFRGVSQSLGHHIANDAVRDWIFGHIEaegkPKfEPTPYDVAIIGDYNIGGDAWSSR 247 Bradyrhizobium ...
P77874       164 IEAVSKKKSKQYEgHTIVPVRCEGFRGVSQSLGHHVANDAIKEWVLDKMDpd-kNQfVATPYDVAIIGDYNIGGDAWSSR 242 Herbaspirillum ...
P25313       163 IEGVSKAKSEELG-KPVVPVRCEGFRGVSQSLGHHIANDVIRDWILPKKTep-kEGfVSTPYDVTIIGDYNIGGDAWASR 240 Azospirillum br...
P00466       164 ISAVANASSKALD-KPVIPVRCEGFRGVSQSLGHHIANDVVRDWILNNREg---QPfETTPYDVAIIGDYNIGGDAWASR 239 Klebsiella pneu...
AAA96263     165 IEAVAKKSSKKLD-IPVIPVRCEGFRGVSQSLGHHIANDAVRDHVLGTGG----DSfEQTDYDVALIGDYNIGGDAWASR 239 Frankia alni
CAA68349     154 ILAVAATASKEIG-IPVHAFSCEGYKGVSQSAGHHIANNTVMTDIIGKGN----KE-QK-KYSINVLGEYNIGGDAWEMD 226 Clostridium pas...
WP_011712867 163 IEAVARKTSAAIN-KPVIPVRCEGFRGVSQSLGHHIANDAIRDWVLENRKd---KMrETGPYDVAVIGDYNIGGDAWASR 238 Magnetococcus m...
WP_010933201 161 VHAVAREMKEKLGdCNVFGFSCEGYRGVSQSAGHHIANNGVFKHMVGNNNe---VK--PGKFKLNLLGEYNIGGDAFEIE 235 Chlorobaculum t...
1G20_A       240 ILLEEMGLRCVAQWSGDGSISEIELTPKVKLNLVHCYRSMNYISRHMEEKYGIPWMEYNFFGPTKTIESLRAIAAKF-DE 318 Azotobacter vin...
P19066       252 ILLEEIGLRVVGNWSGDATLAEVERAPRAKLNLIHCYRSMNYICRHMEERYAIPWMEYNFFGPSQIEASLRKIARHF-GP 330 Sinorhizobium f...
CAA25523     248 ILLEEMGLRVIAQWSGDGSLAELEATPKAKLNILHCYRSMNYISRHMEEKFGIPWCEYNFFGPSKIADSLRRIAGYF-DD 326 Bradyrhizobium ...
P77874       243 ILLEEIGLRVIAQWSGDGTLAEMENTPKAKLNVLHCYRSMNYISRHMEEKFGIPWVEYNFFGPSQIEASLRQIASHF-DD 321 Herbaspirillum ...
P25313       241 ILLEEIGLRVIAQWSGDGTLAELENQPKAKVNLIHSYRSMNYIARHMEEKFGIPWMEYNFFGPSQIAESLRKIAALF-DD 319 Azospirillum br...
P00466       240 ILLEEMGLRVVAQWSGDGTLVEMENTPFVKLNLVHCYRSMNYIARHMEEKHQIPWMEYNFFGPTKIAESLRKIADQF-DD 318 Klebsiella pneu...
AAA96263     240 RILEEMGLRVIAQWSGDGTINEMASTHLSKLNLIHCYRSMNYICTTMEERFGTPWTEFNFFGPTKIISSMRKIAEFF-DD 318 Frankia alni
CAA68349     227 RVLEKIGYHVNATLTGDATYEKVQNADKADLNLVQCHRSINYIAEMMETKYGIPWIKCNFIGVDGIVETLRDMAKCF-DD 305 Clostridium pas...
WP_011712867 239 ILLEEMGLNVVAQWSGDGTLAEMENTPAVKLNLIHCYRSMNYISRHMEAKYGIPWMEYNFFGPTKIAESLRKIAEQF-DD 317 Magnetococcus m...
WP_010933201 236 RLLEKCGITLVASFSGNSTVGAIENAHTADLNVIMCHRSINYMGDMMETKYGIPWMKVNFVGAESTAKSLRKIAEYFgDE 315 Chlorobaculum t...
1G20_A       319 -SIQKKCEEVIAKYKPEWEAVVAKYRPRLEGKR--VMLYIGGLRPRHVIGAYEDLGMEVVGTGYEFAHNDDYDR------ 389 Azotobacter vin...
P19066       331 -TIEERAERVIAKYRPLVDAVIDKYWPRLQGKR--VMLYVGGLRPRHVITAYEDLGMQIVGTGYEFAHNDDYQR------ 401 Sinorhizobium f...
CAA25523     327 -KIKEGAERVIEKYQPLVDAVIAKYRPRLEGKT--VMLYVGGLRPRHVIGAYEDLGMDVIGTGYEFGHNDDYQR------ 397 Bradyrhizobium ...
P77874       322 -KIKEGAERVIAKYKALTDAVIAKYRPRLEGKT--VMLFVGGLRPRHVIDAYGDLGMKVVGTGYEFGHNDDYQR------ 392 Herbaspirillum ...
P25313       320 -TIKENAEKVIAKYQPMVDAVVGDAALRAHGTKgrVPLKPLGPRHRPIVDAYHDLGMEIVGTGYEFAHNDDYQR------ 392 Azospirillum br...
P00466       319 -TIRANAEAVIARYEGQMAAIIAKYRPRLEGRK--VLLYMGGLRPRHVIGAYEDLGMEIIAAGYEFAHNDDYDR------ 389 Klebsiella pneu...
AAA96263     319 -EIKAKTEAAIARYQVRFDEITKAFRPRLEGKR--VMLAVGGLRPRHTIGAYEDLGMEVVGTGYEFAHKDDYTR------ 389 Frankia alni
CAA68349     306 pELTKRTEEVIAEEIAAIQDDLDYFKEKLQGKT--ACLYVGGSRSHTYMNMLKSFGVDSLVAGFEFAHRDDYEGrevipt 383 Clostridium pas...
WP_011712867 318 -KIKEGAEKVIAKYTPIMEGIIGKYRPRLEGKK--VMLYVGGLRPRHVIGAYEDLGMEVVGTGYEFGHNDDYDR------ 388 Magnetococcus m...
WP_010933201 316 -ELKAKVEEVIAEEVPAVKAIIDEIRPRTEGKT--AMLFVGGSRAHHYQDLFSELGMTTIAAGYEFAHRDDYEG------ 386 Chlorobaculum t...
1G20_A       390 ----------------------------------T--------------------------------------------- 390 Azotobacter vin...
P19066       402 ----------------------------------T--------------------------------------------- 402 Sinorhizobium f...
CAA25523     398 ----------------------------------T--------------------------------------------- 398 Bradyrhizobium ...
P77874       393 ----------------------------------T--------------------------------------------- 393 Herbaspirillum ...
P25313       393 ----------------------------------T--------------------------------------------- 393 Azospirillum br...
P00466       390 ----------------------------------T--------------------------------------------- 390 Klebsiella pneu...
AAA96263     390 ----------------------------------T--------------------------------------------- 390 Frankia alni
CAA68349     384 ikidadsknipeitvtpdeqkyrvvipedkveelK--------------------------------------------- 418 Clostridium pas...
WP_011712867 389 ----------------------------------T--------------------------------------------- 389 Magnetococcus m...
WP_010933201 387 ----------------------------------Revlpkikidadsknieelkvtadpelynprkskaeleelkakgle 432 Chlorobaculum t...
1G20_A       391 -------M------------KEMGDSTLLYDDVTGYEFEEFVKRIKPDLIGSGIKEKFIFQKMGIPFREMHSWDYSGPYH 451 Azotobacter vin...
P19066       403 -------G------------HYVKTGTLIYDDATSYELDTFIERIRPDLVGSGIKEKYPVQKMGIPFRQMHSWDYSGPYH 463 Sinorhizobium f...
CAA25523     399 -------Aq-----------HYVKDSTLIYDDVNGYEFERFVERLQPDLVGSGIKEKYVFQKMSVPFRQMHSWDYSGPYH 460 Bradyrhizobium ...
P77874       394 -------T------------HYVEDGTLIYDDVTSYEFEKFVEKIEPDLVGSGIKEKYVFQKMGVPFRQMHSWDYSGPYH 454 Herbaspirillum ...
P25313       394 -------Q------------HYVKEGTLIYDDVTAFELEKFVELMRPDLVASGIKEKYVFQKMGLPFRQMHSWDYSGPYH 454 Azospirillum br...
P00466       391 -------L------------PDLKEGTLLFDDASSYELEAFVKALKPDLIGSGIKEKYIFQKMGVPFRQMHSWDYSGPYH 451 Klebsiella pneu...
AAA96263     391 -------Y------------SMLKEGTVLYDDPTAFELEEFAKFLKPDLMGAGVKEKYVFHKMGIPFRQMHSWDYSGPYH 451 Frankia alni
CAA68349     419 -------KagvplssyggmmKEMHDGTILIDDMNHHDMEVVLEKLKPDMFFAGIKEKFVIQKGGVLSKQLHSYDYNGPYA 491 Clostridium pas...
WP_011712867 390 -------I------------KEMGDSTLIYDDVTGYEFEKFVEKVQPDLVGSGIKEKYIFQKMGIPFRQMHSWDYSGPYH 450 Magnetococcus m...
WP_010933201 433 ingyegmM------------KQMMKKTLVVDDISHYESEKLIEMYKPDIFCAGIKEKYVVQKMGVPLKQLHSYDYGGPYT 500 Chlorobaculum t...
1G20_A       452 GFDGFAIFARDMDMTLNNPCWKKLQAPW 479 Azotobacter vinelandii
P19066       464 GYDGFAIFARDMDLAINNPVWDLYDAPW 491 Sinorhizobium fredii NGR234
CAA25523     461 GYDGFAIFARDMDMAVNSPIWKRTKAPW 488 Bradyrhizobium japonicum
P77874       455 GYDRFAIFARDMDMAINSPVWGMAKAPW 482 Herbaspirillum seropedicae
P25313       455 GYDGFAIFARDMDLAINNPVWGIMKAPF 482 Azospirillum brasilense
P00466       452 GYDGFAIFARDMDMTLNNPAWNELTAPW 479 Klebsiella pneumoniae
AAA96263     452 GVDGFAVFARDMDIAINSPAWDLLEAPW 479 Frankia alni
CAA68349     492 GFRGVVNFGHELVNGIYTPAWKMITPPW 519 Clostridium pasteurianum
WP_011712867 451 GYDGFAIFARDMDMTINNPCWDSFKAPW 478 Magnetococcus marinus
WP_010933201 501 GFKGAVNFYKDIDRMVNNPVWKMIKAPW 528 Chlorobaculum tepidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap