Conserved Protein Domain Family
DPOR_bchL

?
TIGR01281: DPOR_bchL 
light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
The BchL peptide (ChlL in chloroplast and cyanobacteria) is an ATP-binding iron-sulfur protein of the dark form protochlorophyllide reductase, an enzyme similar to nitrogenase. This subunit resembles the nitrogenase NifH subunit. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 130348
View PSSM: TIGR01281
Aligned: 4 rows
Threshold Bit Score: 480.463
Threshold Setting Gi: 13878351
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ZGF0   1 MIIAVYGKGGVGKSTTTSNLAVAIAKEGKRVLQIGCDPKSDSTFTIAGKMIPTVVEILDKFNYHYESIEPGDLIFTGYGG 80  Heliobacillus mobilis
Q9L8J5  25 KVFAIYGKGGIGKSTTSSNLSAAFSKLGKRVVQIGCDPKHDSTFTLTKRLVPTVIDVLQAVHFHTEELRVEDFVYEGYNG 104 Rhodospirillum rubrum
Q9F6X3   3 LILAIYGKGGIGKSTTSANLSAAMALKGAKVLQIGCDPKHDSTFPLTGHLQPTVIDVLDSVNFHLEDVSKEDVIRTGFAG 82  Chloroflexus aurantia...
P54207   1 MKLSVYGKGGIGKSTTSCNISVALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQAKDYHYEDVWPEDVIYRGYGG 80  Synechococcus elongat...
Q9ZGF0  81 VDVVETGGPPAGSGCGGYVVGETVKLLEKMDVMARYDVILFDVLGDVVCGGFATPLQYADLACVVSSNDFDALFAANRIC 160 Heliobacillus mobilis
Q9L8J5 105 VMCVEAGGPPAGTGCGGYVVGQTVKLLKEHHILEDADVVVFDVLGDVVCGGFATPLQHAERALVVAANDFDSIFAANRIA 184 Rhodospirillum rubrum
Q9F6X3  83 VDTLESGGPPAGSGCGGYVVGETVKLLKEFGLYDKYDVIVFDVLGDVVCGGFSAPLNYADYGLIIACNDFDSIFAANRLC 162 Chloroflexus aurantia...
P54207  81 VDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVILFDVLGDVVCGGFAAPLNYSDYCLIITDNGFDALFAANRIA 160 Synechococcus elongat...
Q9ZGF0 161 ESVVEKNMSgYDVKMAGVIGNRCDQV-----DLLETFTRRIETPLMGVVPRKEEIRQSRVKGYTLFELEEMGePVQDMTA 235 Heliobacillus mobilis
Q9L8J5 185 AAIQAKAKN-YDVRLGGIIANRSVAT-----DQIERFNARSGMRTLAHFPDLDVIRRSRLCKSTLFEMEPSP-ELAAVQQ 257 Rhodospirillum rubrum
Q9F6X3 163 LAISQKSQR-HKVKLAGIIANRVDYEygggtNLLDQFAEKVGTKVIGRVPYHDLIRRSRLAGKTLFEME--GpGKEECTR 239 Chloroflexus aurantia...
P54207 161 ASVREKART-HTLRLAGLIGNRTSKR-----DLIDKYIEAVPMPVLEVLPLIEDIRISRVKGKTVFEMAETEpSLLTVCD 234 Synechococcus elongat...
Q9ZGF0 236 EFRKMARYLLSkPDGVIPNAVGTREMFELFKgED 269 Heliobacillus mobilis
Q9L8J5 258 EYLRLAEALWEgVEPLTATPLIDREIFDLLG-FD 290 Rhodospirillum rubrum
Q9F6X3 240 PFEEMAEYLLAqPQATVPQPYHDRAIFEAIGgWR 273 Chloroflexus aurantiacus J-10-fl
P54207 235 YYLNIADQILArPEGVVPKDAADRDLFSLLSdFY 268 Synechococcus elongatus PCC 7942
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap