Conserved Protein Domain Family
thiQ

?
TIGR01277: thiQ 
thiamine ABC transporter, ATP-binding protein
This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130344
View PSSM: TIGR01277
Aligned: 3 rows
Threshold Bit Score: 377.665
Threshold Setting Gi: 125987865
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44986         2 IYLNNVILNDKTLPMCFNLSVNAGERVAIIGESGAGKSTLLNLIAGFEFPAQGEIWLNDKNHTRSAPYERPVSMLFQENN 81  Haemophilus inf...
WP_000916267   2 LKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGALTIDGVDHTTTPPSRRPVSMLFQENN 81  Escherichia coli
WP_000880286   2 LALDKVRYEYEHEWFEFDLNVADGDIVALMGPSGAGKSTLLSLVAGFIEPVSGSIKVNDQSVLGLAPYQRPFSMLFQEHN 81  Vibrio cholerae
P44986        82 LFPHLTVQQNLALGIKPSLKLTALEQEKIEQVACSVGLGDYLERLPNSLSGGQKQRVALARCLLRDKPILLLDEPFSALD 161 Haemophilus inf...
WP_000916267  82 LFSHLTVAQNIGLGLNPGLKLNAVQQEKMHAIARQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALD 161 Escherichia coli
WP_000880286  82 LFAHLTVRENIGLGLHPGLKLNAEQKQQVVDAAQQVGIADYLDRLPEQLSGGQRQRVALARCFVQPNPIWLLDEPFSALD 161 Vibrio cholerae
P44986       162 QKLRVEMLALIAKLCDEKDLTLLLVTHQPSELIGSIDQVLVVENGQISQLQKG 214 Haemophilus influenzae Rd KW20
WP_000916267 162 PALRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGMT 214 Escherichia coli
WP_000880286 162 PLLREEMLALVKQLASERQRTVVMVTHHLSDARAIASQIAFLSQGKVKVVSDC 214 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap