2QRY


Conserved Protein Domain Family
thiB

?
TIGR01276: thiB 
Click on image for an interactive view with Cn3D
thiamine ABC transporter, periplasmic binding protein
This model finds the thiamine (and thiamine pyrophosphate) ABC transporter periplasmic binding protein ThiB in proteobacteria. Completed genomes having this protein (E. coli, Vibrio cholera, Haemophilus influenzae) also have the permease ThiP, described by TIGRFAMs equivalog model TIGR01253. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130343
View PSSM: TIGR01276
Aligned: 3 rows
Threshold Bit Score: 611.26
Threshold Setting Gi: 1174615
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QRY_A  22 KPVLTVYTYDSFAADWGPGPVVKKAFE-ADCNCELKLVALEDGVSLLNRLRXEGKNSKADVVLGLDNNLLDAASKTGLFA 100 Escherichia coli
P31550  19 KPVLTVYTYDSFAADWGPGPVVKKAFE-ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFA 97  Escherichia coli K-12
P44984  23 QQSVNVYSYDSFTSEWGAGPKVKQDFEkAHPQCAINFTPFESVGVLLNRVRLEGKKTKADIVLGLDNFFLEQAEKTGIFA 102 Haemophilus influenza...
2QRY_A 101 KSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVEsDQNWRVIYQDPRTSTPGLGLLLWXQKVY-G 179 Escherichia coli
P31550  98 KSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVEsDQNWRVIYQDPRTSTPGLGLLLWMQKVY-G 176 Escherichia coli K-12
P44984 103 PNNVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQNPPKSLKELVE-RQDLSVIYQDPRTSSVGRGLLVWMNAVYpA 181 Haemophilus influenza...
2QRY_A 180 DDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQp 259 Escherichia coli
P31550 177 DDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQp 256 Escherichia coli K-12
P44984 182 DKIQSAWKELDKHTVTVGKGWSDTYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAARVANHPN- 260 Haemophilus influenza...
2QRY_A 260 ELAQKFLQFXVSPAFQNAIPTGNWXYPVANVTLPAGFEKLTKPATT-LEFTPAEVAAQRQAWISEWQRAVSR 330 Escherichia coli
P31550 257 ELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATT-LEFTPAEVAAQRQAWISEWQRAVSR 327 Escherichia coli K-12
P44984 261 QCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTqTSINPMVNTEQLKNWISTWQTTLTK 332 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap