1F2D


Conserved Protein Domain Family
ACC_deam

?
TIGR01274: ACC_deam 
Click on image for an interactive view with Cn3D
1-aminocyclopropane-1-carboxylate deaminase
This pyridoxal phosphate-dependent enzyme degrades 1-aminocyclopropane-1-carboxylate, which in plants is a precursor of the ripening hormone ethylene, to ammonia and alpha-ketoglutarate. This model includes all members of this family for which function has been demonstrated experimentally, but excludes a closely related family often annotated as putative members of this family. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 130341
View PSSM: TIGR01274
Aligned: 4 rows
Threshold Bit Score: 592.197
Threshold Setting Gi: 7024439
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1F2D_A     2 GVAKFAKYPLTFGPSPISNLNRLSQHLGSK-----VNVYAKREDCNSGLAFGGNKLRKLEYIVPDIVEGDYTHLVSIGGR 76  Cyberlindnera saturnus
Q00740     2 NLQRFPRYPLTFGPTPIQPLARLSKHLGGK-----VHLYAKREDCNSGLAFGGNKTRKLEYLIPEALAQGCDTLVSIGGI 76  Pseudomonas sp. ACP
Q9ZHW3     2 NLNRFERYPLTFGPSPITPLKRLSQHLGGK-----VELYAKREDCNSGLAFGGNKTRKLEYLIPEAIEQGCDTLVSIGGI 76  Enterobacter cloacae
BAA92150  12 PFSTIPRTPLLLGPSPIHPLPRTTADLAKNnphplVTIYAKRDDLNSGYAYGGNKTRKLEYLLADAQAQGCTTLVSIGGV 91  Penicillium citrinum
1F2D_A    77 QSNQTRMVAALAAKLGKKCVLIQEDWVPIPEAekdVYNRVGNIELSRIMGADVRVIEDGFDIGMRKSFANALQELEDAGH 156 Cyberlindnera saturnus
Q00740    77 QSNQTRQVAAVAAHLGMKCVLVQENWVNYSDA---VYDRVGNIQMSRILGADVRLVPDGFDIGFRRSWEDALESVRAAGG 153 Pseudomonas sp. ACP
Q9ZHW3    77 QSNQTRQVAAVAAHLGMKCVLVQENWVNYSDA---VYDRVGNIEMSRIMGADVRLDAAGFDIGIRPSWEKAMSDVVEQGG 153 Enterobacter cloacae
BAA92150  92 QSNHTRQVAAVAARSGLKARLVQEHWVDWTDP---GYESTGNIQLSRLMGADVRLDPSGFGIEHKNTVQRVVEEARGDGE 168 Penicillium citrinum
1F2D_A   157 KPYPIPAGCSEHKYGGLGFVGFADEVINQEVELGIKFDKIVVCCVTGSTTAGILAGMAQYGR------QDDVIAIDASFT 230 Cyberlindnera saturnus
Q00740   154 KPYAIPAGCSDHPLGGLGFVGFAEEVRAQEAELGFKFDYVVVCSVTGSTQAGMVVGFAADGR------ADRVIGVDASAK 227 Pseudomonas sp. ACP
Q9ZHW3   154 KPFPIPAGCSEHPYGGLGFVGFAKKLRQQEKELGFKFNYIVVCSVTGSTQAGMVVGFAADGR------SKNVIGVDASAK 227 Enterobacter cloacae
BAA92150 169 KPYYIPAGASDHPLGGLGFARWAFEVREQEGEMGVFFDTVLVCAVTGSTFAGMIAGFKLLERlypadaKRRVVGIDASAT 248 Penicillium citrinum
1F2D_A   231 SEKTKEQTLRIANNTAKLIGVEH-EFK--DFTLDTRFAYPCYGVPNEGTIEAIRTCAEQEGVLTDPVYEGKSMQGLIALI 307 Cyberlindnera saturnus
Q00740   228 PAQTREQITRIARQTAEKVGLER-DIMraDVVLDERFAGPEYGLPNEGTLEAIRLCARTEGMLTDPVYEGKSMHGMIEMV 306 Pseudomonas sp. ACP
Q9ZHW3   228 PEQTKAQILRIARHTAELVELGR-EITeeDVVLDTRFAYPEYGLPNEGTLEAIRLCGSLEGVLTDPVYEGKSMHGMIEMV 306 Enterobacter cloacae
BAA92150 249 VEATRAQVLRIAKNTAAKIGLSEdDITedDVMLDDRYHAGIYGVPDRQTWDAIEYAAKMEAFITDPVYEGKSFAGMMDMI 328 Penicillium citrinum
1F2D_A   308 KEDYFKPGANVLYVHLGGAPALSAYSSFFPTK 339 Cyberlindnera saturnus
Q00740   307 RNGEFPEGSRVLYAHLGGVPALNGYSFIFRDG 338 Pseudomonas sp. ACP
Q9ZHW3   307 RRGEFPEGSKVLYAHLGGAPALNAYSFLFRDG 338 Enterobacter cloacae
BAA92150 329 RRGEIK-GGNILYAHLGGQLALNAYSELGRTN 359 Penicillium citrinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap