Conserved Protein Domain Family
Trp_5_monoox

?
TIGR01270: Trp_5_monoox 
tryptophan 5-monooxygenase, tetrameric
This model describes tryptophan 5-monooxygenase, a member of the family of tetrameric, biopterin-dependent aromatic amino acid hydroxylases found in metazoans. It is closely related to tetrameric phenylalanine-4-hydroxylase and tyrosine 3-monooxygenase, and more distantly related to the monomeric phenylalanine-4-hydroxylase found in some Gram-negative bacteria. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130337
View PSSM: TIGR01270
Aligned: 4 rows
Threshold Bit Score: 810.624
Threshold Setting Gi: 4104017
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P17752              3 EDNKEN---KDHSLER---------------------------GRASLIFSLKNEVGGLIKALKIFQEkHVNLLHIESRK 52  human
FlyBase:CG9122-PA  34 KDSTTSgssSHPSLGRnasappepprlaiggggqdngrqhspgERISIIFTLRNQVGNLARALQVFQElGINVLHLELSP 113 fruit fly
AAD01923           21 DESTKEecpYINAVQShhq----------------------nvQEMSIIISLVKNMNDMKSIISIFTDrNINILHIESRL 78  Schistosom...
NP_495584          57 EEDVKQlftPTRTVRReasireg--------------deeegvQILTIIVKSSRVSEDISKMIANLPD-HTRIKHLETRD 121 Caenorhabd...
P17752             53 ----SKRRNSE-----FEIFVDCDINREQLNDIFHLLKS-HTNVLSVNLPDNFTLKED---------GMETVPWFPKKIS 113 human
FlyBase:CG9122-PA 114 ----LEMATNQ-----ADVLVDVECDQRRLDQVVKMLNR-EVASVNYTSVNTQGLARApslsacssfDFGDMVWFPRKIS 183 fruit fly
AAD01923           79 grlnMKKHTEKsefepLELLVHVEVPCIEVERLLEELKS-FSSYRIVQNP-LMNLPEAkn-----ptLDDKVPWFPRHIS 151 Schistosom...
NP_495584         122 ----SQDGSSKt----MDVLLEIELFHYGKQEAMDLMRLnGLDVHEVSSTIRPTAIKEqytepgsddATTGSEWFPKSIY 193 Caenorhabd...
P17752            114 DLDHCANrVLMYGSELDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREY 193 human
FlyBase:CG9122-PA 184 DLDKAQN-VLMYGSELDADHPGFKDPVYRKRREQFSAIANNFKHGNPIPRVQYTPEEVKTWGTVFLELHRLYVLHAVPEY 262 fruit fly
AAD01923          152 DLDKVSNsVLMYGKELDADHPGFKDKEYRKRRMMFADIALNYKWGQQIPIVEYTEIEKTTWGRIYRELTRLYKTSACHEF 231 Schistosom...
NP_495584         194 DLDICAKrVIMYGAGLDADHPGFKDTEYRQRRMMFAELALNYKHGEPIPRTEYTSSERKTWGIIYRKLRELHKKHACKQF 273 Caenorhabd...
P17752            194 LKNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHE 273 human
FlyBase:CG9122-PA 263 MDNWPELEKYCGYREDNVPQLQDVSVYLKRKTGFQLRPVAGYLSPRDFLSGLAFRVFHCTQYIRHSSDPFYTPEPDCCHE 342 fruit fly
AAD01923          232 QKNLGLLQDKAGYNEFDLPQLQVVSDFLKARTGFCLRPVAGYLSARDFLSGLAFRVFYCTQYIRHQADPFYTPEPDCCHE 311 Schistosom...
NP_495584         274 LDNFELLERHCGYSENNIPQLEDICKFLKAKTGFRVRPVAGYLSARDFLAGLAYRVFFCTQYVRHHADPFYTPEPDTVHE 353 Caenorhabd...
P17752            274 LLGHVPLLAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQ-------------DGQLRVFGAGLLSSISE 340 human
FlyBase:CG9122-PA 343 LLGHMPLLANSSFAQFSQEIGLASLGASDADIEKLATLYFFTVEFGLCKQa------------DSTFKVYGAGLLSSVAE 410 fruit fly
AAD01923          312 LLGHVPMLADPKFARFSQEIGLASLGTSDEEIKKLATCYFFTIEFGLCRQ-------------DNQLKAYGAGLLSSVAE 378 Schistosom...
NP_495584         354 LMGHMALFADPDFAQFSQEIGLASLGASEEDLKKLATLYFFSIEFGLSSDdaadspvkengsnHERFKVYGAGLLSSAGE 433 Caenorhabd...
P17752            341 LKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSA 420 human
FlyBase:CG9122-PA 411 LQHAITAENKIKKFDPEVTCQQECIITSYQNAYYYTDSFEEAKEQMRAFAESIQRPFGVRYNPYTMSVEVLSNAKKITAV 490 fruit fly
AAD01923          379 LQHALSDKAVIKPFIPMKVINEECLVTTFQNGYFETSSFEDATRQMREFVRTIKRPFDVHYNPYTQSIEIIKTPKSVAKL 458 Schistosom...
NP_495584         434 LQHAVEGSATIIRFDPDRVVEQECLITTFQSAYFYTRNFEEAQQKLRMFTNNMKRPFIVRYNPYTESVEVLNNSRSIMLA 513 Caenorhabd...
P17752            421 MNELQHDLDVVSDALAKVS 439 human
FlyBase:CG9122-PA 491 VSELRGDLSIVCSALRKIS 509 fruit fly
AAD01923          459 VQDLQFELTAINESLLKMN 477 Schistosoma mansoni
NP_495584         514 VNSLRSDINLLAGALHYIL 532 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap