Conserved Protein Domain Family
Tyr_3_monoox

?
TIGR01269: Tyr_3_monoox 
tyrosine 3-monooxygenase, tetrameric
This model describes tyrosine 3-monooxygenase, a member of the family of tetrameric, biopterin-dependent aromatic amino acid hydroxylases found in metazoans. It is closely related to tetrameric phenylalanine-4-hydroxylase and tryptophan 5-monooxygenase, and more distantly related to the monomeric phenylalanine-4-hydroxylase found in some Gram-negative bacteria.
Statistics
?
PSSM-Id: 130336
View PSSM: TIGR01269
Aligned: 3 rows
Threshold Bit Score: 793.366
Threshold Setting Gi: 3183187
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAA62877  48 KQTVLEEARSKANdYGLTEDEILLANAASESSDAEAAMQSAALVVRLKEgISSLGRILKAIETFHGTVQHVESRQSRVEG 127 fruit fly
O42091    36 RQSLIEDARKERE-AAAAAESSEASEQIVFDEEDGKALLNLFFTLRSSK-IPALSRALKVFETFEAKIHHLETRTRRKPK 113 European eel
O17446    16 KSSTVELNHNEKD--GRIHSIIINFHPITHEQ-S-----NNQFYIQT------LHEILKYIIDKKLNLVHFETRPTLTLS 81  Schistosoma mansoni
AAA62877 128 -----VDHDVLIKLDMTRGNLLQLIRSLRQsgsfSSMNLMADNnlNVKAPWFPKHASELDNCNHLMTKYEPDLDMNHPGF 202 fruit fly
O42091   114 ds--lEDLEYFVRCEVHLADVSTLISSIRR----IAEDVRTTK--EVKFHWFPKKISELDSCHHLVTKFDPDLDQDHPGF 185 European eel
O17446    82 nanrdVQYSCLITLEANEINMSLLYEELRGnsfiSGINLLNNQ---ESEDWYPKHISDLDKCQHLLRKFQPELQTDHPGF 158 Schistosoma mansoni
AAA62877 203 ADKVYRQRRKEIAEIAFAYKYGDPIPFIDYSDVEVKTWRSVFKTVQDLAPKHACAEYRAAFQKLQDEQIFVETRLPQLQE 282 fruit fly
O42091   186 TDPVYRQRRRMIGEIAFRYKHGEPIPRVEYTEEEIGTWREVYSTLRDLYTTHACSEHLEAFRLLERHCGYSPNSIPQLED 265 European eel
O17446   159 HDKVYRERREAIAKIAFQYKYGDRIPEVEYTKEEIETWGLVFTKMKAVHASRACREYIDGFQLLEKYCNYNSESIPQLQT 238 Schistosoma mansoni
AAA62877 283 MSDFLRKNTGFSLRPAAGLLTARDFLASLAFRIFQSTQYVRHVNSPYHTPEPDSIHELLGHMPLLADPSFAQFSQEIGLA 362 fruit fly
O42091   266 VSHFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCVHELLGHVPMLADRTFAQFSQNIGLA 345 European eel
O17446   239 ICEFMHRTSGFRIRPVAGLVSPKDFLASLAFRVFQCTQYIRHHSRPMHTPEPDCIHELIGHMPMLVNRQFADFSQELGLA 318 Schistosoma mansoni
AAA62877 363 SLGASDEEIEKLSTVYWFTVEFGLCKEHGQIKAYGAGLLSSYGELLHAISDKCEHRAFEPASTAVQPYQDQEYQPIYYVA 442 fruit fly
O42091   346 SLGASEEDIEKLSTLYWFTVEFGLCKQGDGVKAYGAGLLSSYGELVHSLSDEPERREFDPEAAAAEPYQDQNYQSVYFVS 425 European eel
O17446   319 SLGASEEEITRLSTLYWFTVEFGLCNENGETRALGAGIMSSYGELENAFSDLSVKEPFNINDAAVQVYDDVGYQKIYFVT 398 Schistosoma mansoni
AAA62877 443 ESFEDAKDKFRRWVSTMSRPFEVRFNPHTERVEVLDSVDKLETLVHQMNTEILHLTNAISKLR 505 fruit fly
O42091   426 ESFTDAKEKLRVYAAGINRPFSVRFDPYTYSIEVLDNPLKIRGGLESVKDELKVLTDALNVLA 488 European eel
O17446   399 ESIESMKRELRNYINTSGKSTIPIYDPITETVHMKSRFSIRKELLKHVKEEIGQLDTLLNHSN 461 Schistosoma mansoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap