Conserved Protein Domain Family
Phe4hydrox_tetr

?
TIGR01268: Phe4hydrox_tetr 
phenylalanine-4-hydroxylase, tetrameric form
This model describes the larger, tetrameric form of phenylalanine-4-hydroxylase, as found in metazoans. The enzyme irreversibly converts phenylalanine to tryosine and is known to be the rate-limiting step in phenylalanine catabolism in some systems. It is closely related to metazoan tyrosine 3-monooxygenase and tryptophan 5-monoxygenase, and more distantly to monomeric phenylalanine-4-hydroxylases of some Gram-negative bacteria. The member of this family from Drosophila has been described as having both phenylalanine-4-hydroxylase and tryptophan 5-monoxygenase activity (. However, a Drosophila member of the tryptophan 5-monoxygenase clade has subsequently been discovered.
Statistics
?
PSSM-Id: 130335
View PSSM: TIGR01268
Aligned: 4 rows
Threshold Bit Score: 832.944
Threshold Setting Gi: 4150981
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P90925    15 AMESYVAD---VNADIGkTTIVFTLREK---AGALAETLKLFQAHDVNLSHIESRPSKTHEg-CYEVLVEFAEAEDhRKI 87  Caenorhabditis elegans
P00439    20 QETSYIEDn--CNQNGA-ISLIFSLKEE---VGALAKVLRLFEENDVNLTHIESRPSRLKKd-EYEFFTHLDKRSL-PAL 91  human
P17276    15 EDSAYIVEgvdIKEARN-TCLLFSPKDSslsSGALANILAIFKKHDINLVHIESRSSLRVP--GYEFFVEADGKS--GAL 89  fruit fly
CAA76184  17 GEASYIPVqtpTGENSAnLSLIFSLKDE---QGSLVTSLKPFQDMGINMTHLESRPSKSNPgsEYDFYVDC-VCPP-DKK 91  Geodia cydonium
P90925    88 EGVIEHFQQKAEkkVLVQDWNTKNKQNKdsVPWFPQKINDIDQFANRILSYGAELDADHPGFKDMTYRERRKFFADIAFN 167 Caenorhabditis elegans
P00439    92 TNIIKILRHDIG--ATVHELSRDKKKDT--VPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYN 167 human
P17276    90 GKAIEDVKEQC---SYFNIISRDYKDNAtaVPWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIAYN 166 fruit fly
CAA76184  92 EDLLSSLRANS---LTVNILSRDPGEDE--VPWFPRKIAEIDRFANQVLSYGAELDSDHPGFTDAVYRARRKQFADIAFH 166 Geodia cydonium
P90925   168 FKHGDKIPTITYTDEEIATWRTVYNELTVMYPKNACQEFNYIFPLLQQNCGFGPDRIPQLQDVSDFLKDCTGYTIRPVAG 247 Caenorhabditis elegans
P00439   168 YRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAG 247 human
P17276   167 YKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIPQLEDVSNFLRDCTGFTLRPVAG 246 fruit fly
CAA76184 167 CKHGQPIPRVEYTPQEIDTWRTIFTNLVDLFPTHACKEHNHVFPLLQENCGYREDNIPQLEEVSQYLQSCTGFRLRPVAG 246 Geodia cydonium
P90925   248 LLSSRDFLAGLAFRVFHSTQYIRHHSAPKYTPEPDICHELLGHVPLFADVEFAQFSQEIGLASLGAPDDVIEKLATLYWF 327 Caenorhabditis elegans
P00439   248 LLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWF 327 human
P17276   247 LLSSRDFLAGLAFRVFHSTQYIRHPSKPMYTPEPDVCHELMGHVPLFADPAFAQFSQEIGLASLGAPDDYIEKLSTIFWF 326 fruit fly
CAA76184 247 LLSSRDFLAGLAFRVFHSTQYIRHYSQPNYTPEPDVCHELIGHVR-CSVILFAQFSQEIGLASLGAPEEYVQQLATLYWF 325 Geodia cydonium
P90925   328 TIEFGICQQDGEKKAYGAGLLSSFGELQYALSDKPEVVDFDPAVCCVTKYPITEYQPKYFLAESFASAKNKLKSWAATIN 407 Caenorhabditis elegans
P00439   328 TVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIP 407 human
P17276   327 TVEYGVCRQEGELKAYGAGLLSSYGELEYCLTDKPQLKDFEPEVTGVTKYPITQFQPLYYVADSFETAKEKTIKFANSIP 406 fruit fly
CAA76184 326 TIEFGLCKQDGQTKAYGAGLISSFGELQYCLSDKPEVRPLDPFKTSLQTYPITEMQPVYFLANSFEDAKQKLMEFARTIP 405 Geodia cydonium
P90925   408 RPFQIRYNAYTQRVEILDKVAALQRLARDIRSDISTLEEALGKVN 452 Caenorhabditis elegans
P00439   408 RPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK 452 human
P17276   407 RPFGVRYNAYTQSVEVLDSKPQISNLMDNINSEFQILQNAVAKLR 451 fruit fly
CAA76184 406 RPFSVRYNPYTQSVDIIKDKSSVQTLVNDIRYEVDILQDALRKLD 450 Geodia cydonium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap