3TCY


Conserved Protein Domain Family
Phe4hydrox_mono

?
TIGR01267: Phe4hydrox_mono 
Click on image for an interactive view with Cn3D
phenylalanine-4-hydroxylase, monomeric form
This model describes the smaller, monomeric form of phenylalanine-4-hydroxylase, as found in a small number of Gram-negative bacteria. The enzyme irreversibly converts phenylalanine to tryosine and is known to be the rate-limiting step in phenylalanine catabolism in some systems. This family is of biopterin and metal-dependent hydroxylases is related to a family of longer, multimeric aromatic amino acid hydroxylases that have additional N-terminal regulatory sequences. These include tyrosine 3-monooxygenase, phenylalanine-4-hydroxylase, and tryptophan 5-monoxygenase. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130334
View PSSM: TIGR01267
Aligned: 3 rows
Threshold Bit Score: 430.832
Threshold Setting Gi: 499215200
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3TCY_A        31 DFTLPQPLDRYSAEDHATWATLYQRQCKLLPGRACDEFLEGLERLEVDADRVPDFNKLNEKLMAATGWKIVAVPGLIPDD 110 Chromobacterium...
WP_003114241   9 RQPDDNGFIHYPETEHQVWNTLITRQLKVIEGRACQEYLDGIEQLGLPHERIPQLDEINRVLQATTGWRVARVPALIPFQ 88  Pseudomonas
WP_010912740  25 DFTVAQDYD-YSDEEQAVWRTLCDRQTKLTRKLAHHSYLDGVEKLGL-LDRIPDFEDVSTKLRKLTGWEIIAVPGLIPAA 102 Mesorhizobium loti
3TCY_A       111 VFFEHLANRRFPVTWWLREPHQLDYLQEPDVFHDLFGHVPLLINPVFADYLEAYGKGGVKAKALGALpMLARLYWYTVEF 190 Chromobacterium...
WP_003114241  89 TFFELLASQQFPVATFIRTPEELDYLQEPDIFHEIFGHCPLLTNPWFAEFTHTYGKLGLKASKEERV-FLARLYWMTIEF 167 Pseudomonas
WP_010912740 103 PFFDHLANRRFPVTNWLRTRQELDYIVEPDMFHDFFGHVPVLSQPVFADFMQMYGKKAGDIIALGGDeMITRLYWYTAEY 182 Mesorhizobium loti
3TCY_A       191 GLINTPAG-MRIYGAGILSSKSESIYCLdSASPNRVGFDLMRIMNTRYRIDTFQKTYFVIDSFKQLFDATAP-DFAPLYL 268 Chromobacterium...
WP_003114241 168 GLVETDQG-KRIYGGGILSSPKETVYSL-SDEPLHQAFNPLEAMRTPYRIDILQPLYFVLPDLKRLFQLAQE-DIMALVH 244 Pseudomonas
WP_010912740 183 GLVQEAGQpLKAFGAGLMSSFTELQFAVeGKDAHHVPFDLETVMRTGYEIDKFQRAYFVLPSFDALRDAFQTaDFEAIVA 262 Mesorhizobium loti
3TCY_A       269 QLADAQPWGA 278 Chromobacterium violaceum
WP_003114241 245 EAMRLGLHAP 254 Pseudomonas
WP_010912740 263 RRKDQKALDP 272 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap