1QQJ


Conserved Protein Domain Family
fum_ac_acetase

?
TIGR01266: fum_ac_acetase 
Click on image for an interactive view with Cn3D
fumarylacetoacetase
This enzyme catalyzes the final step in the breakdown of tyrosine or phenylalanine to fumarate and acetoacetate. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 162276
View PSSM: TIGR01266
Aligned: 5 rows
Threshold Bit Score: 700.449
Threshold Setting Gi: 489191037
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QQJ_A         2 SFIPVAE-DSDFPIQNLPYGVFSTQSNPKPRIGVAIGDQILDLSVIKH--LFTGP-ALSKHQHVFDETTLNNFMGLGQAA 77  house mouse
P35505         2 SFIPVAE-DSDFPIQNLPYGVFSTQSNPKPRIGVAIGDQILDLSVIKH--LFTGP-ALSKHQHVFDETTLNNFMGLGQAA 77  house mouse
AAB06900       3 SFVSVPQ-NSDFPIQNLPYGVFSTKADSSRHIGVAIGDQILNLAEIAN--LFDGP-QLKAHQDVFKQSTLNAFMALPRPA 78  Caenorhabditis ...
WP_003100400   9 SWVASANgHADFPLQNLPLGIFS-RAGLSPRCGVAIGDSILDLDAALAagLFEG--AAGEAAEATRGGALNAFFALGKPA 85  Pseudomonas
AAA85778       3 SWLQIPK-NSPFSLANIPFGIISSSKLSSRVPAIAIGDYALDLSKFASsgGFSQLpVIQPHLNVFNQSTLNAFAALGRPV 81  Aspergillus nid...
1QQJ_A        78 WKEARASLQNLLS---ASQARLRDDKELRQRAFTSQASATMHLPATIGDYTDFYSSRQHATNVGIMFRGKENALLPNWLH 154 house mouse
P35505        78 WKEARASLQNLLS---ASQARLRDDKELRQRAFTSQASATMHLPATIGDYTDFYSSRQHATNVGIMFRGKENALLPNWLH 154 house mouse
AAB06900      79 WLEARARIQQLLS---EDCAVLRDNAHLRSRALVAQSDATMHLPAQIGDYTDFYSSIHHATNVGIMFRGKENALMPNWKW 155 Caenorhabditis ...
WP_003100400  86 RVALRQRLLELLG------EG----AAERPELLHPAAECQMHLPARIGDYTDFYVGIRHAENVGKLFR-PDNPLLPNYKH 154 Pseudomonas
AAA85778      82 HRQVREYIQKVFStetPFPQILRDNAALQKEALLPLSEVTNHLPMQIGDYTDFYAGLNHAYNVGVLFRGPDNALQPNYKH 161 Aspergillus nid...
1QQJ_A       155 LPVGYHGRASSIVVSGTPIRRPMGQMRPD---NSKPPVYGACRLLDMELEMAFFVG-PGNRFGEPIPISKAHEHIFGMVL 230 house mouse
P35505       155 LPVGYHGRASSIVVSGTPIRRPMGQMRPD---NSKPPVYGACRLLDMELEMAFFVG-PGNRFGEPIPISKAHEHIFGMVL 230 house mouse
AAB06900     156 LPVGYHGRASSIVVSGTDLKRPVGQTKAP---DAEVPSFGPSKLMDFELEMAFFVGgPENELGTRVPIEKAEDRIFGVVL 232 Caenorhabditis ...
WP_003100400 155 VPIGYHGRASTVRVSGSEVRRPNGQTLPA---GASEPVFGPCARLDYELELGIWIG-QGNALGEAIPVSRAAEHIAGFCL 230 Pseudomonas
AAA85778     162 LPVAYHGRASSVVTSGTPLHRPQGQILTNpaaNPKLPTFSPCKKLDIELELAFFVS-TPNDLGHPVHIDKAEDHIFGVVL 240 Aspergillus nid...
1QQJ_A       231 MNDWSARDIQQWEYVPLGPFLGKSFGTTISPWVVPMDALMPFVVP---NPKQDPKPLPYLCHS---QPYTFDINLSVSLK 304 house mouse
P35505       231 MNDWSARDIQQWEYVPLGPFLGKSFGTTISPWVVPMDALMPFVVP---NPKQDPKPLPYLCHS---QPYTFDINLSVSLK 304 house mouse
AAB06900     233 MNDWSARDIQAWEYVPLGPFLAKSFATTVSPWVVSIEALRPYFVE---NPVQDPVPPAYLHHD---DPFTLDINLAVSIR 306 Caenorhabditis ...
WP_003100400 231 LNDWSARDIQAWEYQPLGPFLSKSFITSVSPWVVTAEALEPFRRAqpaRPEGDPRPLPYLYDDndqAHGAFDIELEVLLL 310 Pseudomonas
AAA85778     241 MNDWSARDIQAWEYVPLGPFNAKNFGTTITPWVVLIDALEPFRTVg-lEPGNRESLLPYLREKr--ADTAYDIPLEVEVT 317 Aspergillus nid...
1QQJ_A       305 GEGmSQ----AATICRSNFKHMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGSDPESFGSMLELSWkGTKAIDVGQGQT 380 house mouse
P35505       305 GEGmSQ----AATICRSNFKHMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGSDPESFGSMLELSWkGTKAIDVEQGQT 380 house mouse
AAB06900     307 PEGdAV----DHIVCKTNFKHLYWTLKQQLAHHTVNGCNLRAGDLLGSGTVSGPEEGAYGSMLELSWrGAKEVPVG-SEI 381 Caenorhabditis ...
WP_003100400 311 TEGlREkglpPQRLTLSNSLSMYWTVAQMVAHHSVNGCQLQPGDLFGSGTLSGAEPGQFGSLLEITAgGKQPVQLASGET 390 Pseudomonas
AAA85778     318 NAG-GE----PTVISRSNAKNLLYSFPQMLAHHTITGCNLNTGDLLGSGTISGKENQTEGSFLEQTN-GKNPIKLADGSE 391 Aspergillus nid...
1QQJ_A       381 RTFLLDGDEVIITGHCQGDGYR-VGFGQCAGKVLPAL 416 house mouse
P35505       381 RTFLLDGDEVIITGHCQGDGYR-VGFGQCAGKVLPAL 416 house mouse
AAB06900     382 RKFLKDGDEVNLSGVCEKNGVR-IGFGECRGKVLPAD 417 Caenorhabditis elegans
WP_003100400 391 RRFLEDGDEVILRARCKREGHVsIGFGECRGKVLAAL 427 Pseudomonas
AAA85778     392 RLFLEDGDTVILRGMAGTEGNY-VGFGDCAGTILPPV 427 Aspergillus nidulans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap