1FW1,2JL4


Conserved Protein Domain Family
maiA

?
TIGR01262: maiA 
Click on image for an interactive view with Cn3D
maleylacetoacetate isomerase
Maleylacetoacetate isomerase is an enzyme of tyrosine and phenylalanine catabolism. It requires glutathione and belongs by homology to the zeta family of glutathione S-transferases. The enzyme (EC 5.2.1.2) is described as active also on maleylpyruvate, and the example from a Ralstonia sp. catabolic plasmid is described as a maleylpyruvate isomerase involved in gentisate catabolism. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 273527
View PSSM: TIGR01262
Aligned: 15 rows
Threshold Bit Score: 289.611
Threshold Setting Gi: 3914021
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FW1_A         7 ILYSYFRSSCSWRVRIALALKGIDYKTVPINLIKdggQQFSKDFQALNPMKQVPTLKIDg-------ITIHQSLAIIEYL 79  human
Q18938         7 VLYSYWRSSCSWRVRIALALKNVDYEYKTVDLLS---EEAKSKLKEINPAAKVPTFVVDg-------QVITESLAIIEYL 76  Caenorhabditis ...
O43708         7 ILYSYFRSSCSWRVRIALALKGIDYKTVPINLIKdrgQQFSKDFQALNPMKQVPTLKIDg-------ITIHQSLAIIEYL 79  human
AAF60754       6 ILYSSWSSGCSSRVRTALALKKIDYEYQPVNLLN---KQKEQEFHGNNPAEKVPILKINg-------LTLTESMAIIEYL 75  Caenorhabditis ...
CAA73584       2 LYYGYWRSSAAWRCRIAFNLKKIAPEFVAVHLTRdggAQRTEEFRVINPQKRVPALDLNg-------AVLTQSLAIIEWL 74  Sphingomonas sp.
AAD12621       2 KLYNFWRSGTSHRLRIALNLKGVPYEYLAVHLGKe--EHLKDAFKALNPQQLVPALDTGa-------QVLIQSPAIIEWL 72  Ralstonia sp. U2
Q9X4F7         6 VLYDYWRSSASYRVRIALNLCGEAYRSVPVDLLAk--AHRAPEHLARNPQGLVPVLDIDg-------ERLTQSLAIIEYL 76  Sinorhizobium m...
O43123        10 TLYTYFRSSCSARLRIALALRSISYTSVPINLLKg--EQSSTKNTAVNPSATVPTLIIEhvdrsqspITITQSLAALEYL 87  Aspergillus nid...
2JL4_A         3 KLYNFWRSGTSHRLRIALNLKGVPYEYLAVHLGKe--EHLKDAFKALNPQQLVPALDTGa-------QVLIQSPAIIEWL 73  Ralstonia sp. U2
WP_003113505   2 KLYTYYRSTSSYRVRIALALKGLDYQSLPVNLIRdggEHRQPAYLALNPQGRVPALQVDe------gELLIQSPAIIEYL 75  Pseudomonas aer...
1FW1_A        80 EETRPTPR--LLP--QDPKKRASVRMISDLIAGGIQPLQNLSVLKQVG------EEMQLTWAQNAITCGFNALEQILQ-- 147 human
Q18938        77 EETHPDVP--LLP--KDPIKRAHARAISLLVASGIQPLHNLKVLQLLNkk---eAGFGGQFAKQFVVEGLTALEILLK-- 147 Caenorhabditis ...
O43708        80 EEMRP-TPr-LLP--QDPKKRASVRMISDLIAGGIQPLQNLSVLKQVG------EEMQLTWAQNAITCGFNALEQILQ-- 147 human
AAF60754      76 DEIYPDPP--LLP--KEPELKARARAIAFHIASNIQPLQNKPIYLMLNek---ePGYGDFWCQHFISKGFKALEELLQ-- 146 Caenorhabditis ...
CAA73584      75 EETIPEPA--LLP--DDPWSRAQVRAFALAIACDIHPLQNLEVQQYLRgklnleQSAVSDWLGHWIGNGLLACEALLGsq 150 Sphingomonas sp.
AAD12621      73 EEQYPTPA--LLP--ADADGRQRVRALAAIVGCDIHPINNRRILEYLRktfgadEAAINAWCGTWISAGFDAYEALLAvd 148 Ralstonia sp. U2
Q9X4F7        77 AETRDGTG--LLP--AHPIDRQRVRALSYAVAMDIHPVCNLGVVARVMagagdgEAARREWMQKFIGEGLAAFERMLDh- 151 Sinorhizobium m...
O43123        88 DEAFPDNPnpLLPpiSNPQQRALVRSLASIIACDIQPVTNLRILQRVAp----fGVDRAAWSKDLIEAGFAAYEAIAR-- 161 Aspergillus nid...
2JL4_A        74 EEQYPTPA--LLP--ADADGRQRVRALAAIVGCDIHPINNRRILEYLRktfgadEAAINAWCGTWISAGFDAYEALLAvd 149 Ralstonia sp. U2
WP_003113505  76 EERYPQPA--LLS--SDPLRRARERGVAALVGCDIHPLHNASVLNLLRqwg-hdEEQVRQWIGHWVGQGLAAVEQLIG-- 148 Pseudomonas aer...
1FW1_A       148 STAGIYCVGDEVTMADLCLVPQVANAE-RFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTP 211 human
Q18938       148 QHSGKYAVGDDVTIADLSIPPLIYSAN-RFNLDLSPYPTVNRINETLADIPAFIAAHPDNQPDTG 211 Caenorhabditis elegans
O43708       148 STAGIYCVGDEVTMADLCLVPQVANAE-RFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTP 211 human
AAF60754     147 MHSGDFCVGNQISIADICLPSIVYNAIeKYHVDMTPYPIITRISNKLAELPEFQVAHPNNQPDAP 211 Caenorhabditis elegans
CAA73584     151 PSNQAFAFGASPTLADICLAPQLYSAE-RFGISLNDMPRLRTLGASYADHPAFVDAHAHNQPDSE 214 Sphingomonas sp.
AAD12621     149 PKRGRYSFGDTPTLADCYLVPQVESAR-RFQVDLTPYPLIRAVDAACGELDAFRRAAPAAQPDSA 212 Ralstonia sp. U2
Q9X4F7       152 PATGAFCHGDRPTMADLCLVPQVYNAR-RWDVDLAACPLLVAIDRRCAGIDAFQRAHPDRAKP-- 213 Sinorhizobium meliloti 1021
O43123       162 DSAGVFSVGDTITMADVCLIPAVWGAE-RAGVNLGQYPTIKRVAEALEKENAVKEGHWRTQQDTP 225 Aspergillus nidulans FGSC A4
2JL4_A       150 PKRGRYSFGDTPTLADCYLVPQVESAR-RFQVDLTPYPLIRAVDAACGELDAFRRAAPAAQPDSA 213 Ralstonia sp. U2
WP_003113505 149 DQG--WCFGDRPGLADVYLVPQLYAAE-RFGVALDAWPRIRRVADLAAAHPAFRQAHPANQPDTP 210 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap