2FPR


Conserved Protein Domain Family
hisB_Nterm

?
TIGR01261: hisB_Nterm 
Click on image for an interactive view with Cn3D
histidinol-phosphatase
This model describes histidinol phosphatase. All known examples in the scope of this model are bifunctional proteins with a histidinol phosphatase domain followed by an imidazoleglycerol-phosphate dehydratase domain. These enzymatic domains catalyze the ninth and seventh steps, respectively, of histidine biosynthesis. [Amino acid biosynthesis, Histidine family]
Statistics
?
PSSM-Id: 130328
View PSSM: TIGR01261
Aligned: 7 rows
Threshold Bit Score: 284.682
Threshold Setting Gi: 497559873
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FPR_A        14 QKYLFIDRDGTLISEPPSDFQVDRFDKLAFEPGVIPQLLKLQKAgYKLVMITNQDGLGTQSFPQADFDGPHNLMMQIFTS 93  Escherichia col...
Q9ZHE4         3 QKILFIDRDGTLIHEPSNDCQVDAINKLEFKKYIISSLCQLMNFgYKFVMVTNQDGLGSKSFPRENFNIPHFFMLNIFRS 82  Buchnera aphidi...
WP_000080103   3 QKYLFIDRDGTLISEPPSDFQVDRFDKLAFEPGVIPELLKLQKAgYKLVMITNQDGLGTQSFPQADFDGPHNLMMQIFTS 82  Shigella flexneri
WP_009874057   3 NKILFIDRDGTLIDEPINTFQVDSINKLVFKKYVISSLRKLVELdYKLIMITNQDGLGTESFPLQDFSTAHLFMLSVFRS 82  Buchnera aphidi...
KDA19346       3 QKILFIDRDGTLIEEPKSDFQIDTLEKLRFEKDAIPTLLKLKKFgFKFVMVSNQDGLGTPSFPKENFEIAHEKMLDILKS 82  Campylobacter j...
WP_023907508   2 TPIVFIDRDGTLIEEPP-DFQIDAYEKLRLVNGVIPALLKLRDAgYHFVIVTNQDGLGSPAYPQASFDGPNALMLQIFSS 80  Xylella fastidiosa
P44327         2 QPTLFIDRDGTLIDEPKTDFQIDSLEKLKLEPKVIPALLRLKAK-YRFVIVSNQDGLGTDAFPQTDFDKPHNVMMALFES 80  Haemophilus inf...
2FPR_A        94 QGVQFDEVLICPHLPADECDCRKPKVKLVERYLAEQAMDRANSYVIGDRATDIQLAENMGINGLRYDRETLN----WPMI 169 Escherichia col...
Q9ZHE4        83 EGIIFEDVLICPHFLDDNCDCRKPQTKLLKPWLKKNKIDKQRSYVIGDRETDMELAKNINLTGIQYKEKEFN----WIDI 158 Buchnera aphidi...
WP_000080103  83 QGVQFDEVLICPHLPADECDCRKPKVKLVERYLAEQAMDRANSYVIGDRATDIQLAENMGITGLRYDRETLN----WPMI 158 Shigella flexneri
WP_009874057  83 EGVIFDDILICPHFLDDDCVCRKPKIKMIEPWL--DKIDLKKSYVIGDRDTDMQLSNNLKIKGIKYKEDICN----WLHI 156 Buchnera aphidi...
KDA19346      83 CGIEFQDIFICPHFENENCACRKPKTAMLEEYIKHELYDKEQSFVIGDRESDMILASNLGVRGLKYG--ELS----WKEI 156 Campylobacter j...
WP_023907508  81 QGIVFRDVLIDRSWPTDNAPTRKPGIGLMVAYLQDRDIDWARSAMVGDRPTDLQFAENLNIRGFQLRTPQFGgdwdWDGI 160 Xylella fastidiosa
P44327        81 QGITFDEVLICPHKPEENCLCRKPKIKLLDHYIRKNLFDIDRSFVIGDRETDVQLAENLGIRAIQYDPQKMN----WDLI 156 Haemophilus inf...
2FPR_A       170 GEQLT 174 Escherichia coli O157:H7
Q9ZHE4       159 TKEII 163 Buchnera aphidicola str. Sg (Schizaphis graminum)
WP_000080103 159 GEQLT 163 Shigella flexneri
WP_009874057 157 TKYII 161 Buchnera aphidicola
KDA19346     157 ENEIL 161 Campylobacter jejuni 255
WP_023907508 161 AHTLA 165 Xylella fastidiosa
P44327       157 AEKLL 161 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap