1L6T,1YCE


Conserved Protein Domain Family
ATP_synt_c

?
TIGR01260: ATP_synt_c 
Click on image for an interactive view with Cn3D
ATP synthase, F0 subunit c
This model describes the subunit c in F1/F0-ATP synthase, a membrane associated multisubunit complex found in bacteria and organelles of higher eukaryotes, namely, mitochondria and chloroplast. This enzyme is principally involved in the synthesis of ATP from ADP and inorganic phosphate by coupling the energy derived from the proton electrochemical gradient across the biological membrane. A brief description of this multisubunit enzyme complex: F1 and F0 represent two major clusters of subunits. The functional role of subunit c, which is the part of F0 cluster, has been delineated in-vitro reconstitution experiments. Overall experimental proof exists that demonstrate the electrochemical gradient is converted into a rotational torque that leads to ATP synthesis. [Energy metabolism, ATP-proton motive force interconversion]
Statistics
?
PSSM-Id: 130327
View PSSM: TIGR01260
Aligned: 8 rows
Threshold Bit Score: 60.8855
Threshold Setting Gi: 114668
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1L6T_A 20 AAIGDAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVNAIPMIAVGLGLYVMFA 77  Escherichia coli
O51877 20 AAIGAAIGIGILGSKFLEGAARQPDLVPLLRTQFFVVMGLVDAIPMIAVGLGLYMLFA 77  Buchnera aphidicola str. Sg (Schizaphis gram...
P12991 19 ASLGTAIGFALLGGKFLEGAARQPEMAPMLQVKMFIIAGLLDAVPMIGIVIALLFTFA 76  Vibrio parahaemolyticus
P43721 19 AALGTAIGFAILGGKFLESSARQPELASSLQTKMFIVAGLLDAIAMIAVGISLLFIFA 76  Haemophilus influenzae Rd KW20
P26682 13 AAIGAGYGNGQVISKTIESMARQPEMSGQLRTTMFIGVALVEAVPILGVVIALILVFA 70  Enterococcus hirae ATCC 9790
P21905 24 AGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAIAESTGIYSLVIALILLYA 81  Propionigenium modestum
P00844 20 AAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFA 77  Escherichia coli
1YCE_A 24 AGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALILLYA 81  Ilyobacter tartaricus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap