Conserved Protein Domain Family
rim_protein

?
TIGR01257: rim_protein 
retinal-specific rim ABC transporter
This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130324
View PSSM: TIGR01257
Aligned: 3 rows
Threshold Bit Score: 4924.71
Threshold Setting Gi: 6707663
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P78363      1 MGFVRQIQLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNANPLYSHHECHFPNKAMPSAGMLPWLQGIFCNVNNP 80   human
AAC48716    1 MGFARQIKLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNVNPLYSKHECHFPNKAMPSAGMLPWLQGIFCNVNNP 80   cattle
AAC23916    1 MGFLRQIQLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNANPLYSQHECHFPNKAMPSAGLLPWLQGIFCNMNNP 80   house mouse
P78363     81 CFQSPTPGESPGIVSNYNNSILARVYRDFQELLMNAPESQHLGRIWTELHILSQFMDTLRTHPERIAGRGIRIRDILKDE 160  human
AAC48716   81 CFQSPTAGESPGIVSNYNNSILARVYRDFQELLMDAPESQHLGQVWRELRTLSQLMNTLRMHPERIAGRGIRIREVLKDD 160  cattle
AAC23916   81 CFQNPTPGESPGTVSNYNNSILARVYRDFQELFMDTPEVQHLGQVWAELRTLSQFMDTLRTHPERFAGRGLQIRDILKDE 160  house mouse
P78363    161 ETLTLFLIKNIGLSDSVVYLLINSQVRPEQFAHGVPDLALKDIACSEALLERFIIFSQRRGAKTVRYALCSLSQGTLQWI 240  human
AAC48716  161 EMLTLFLVKNIGLSDSVVYLLVNSQVRPEQFARGVPDLMLKDIACSEALLERFLIFPQRRAAQTVRGSLCSLSQGTLQWM 240  cattle
AAC23916  161 EALTLFLMRNIGLSDSVAHLLVNSQVRVEQFAYGVPDLELTDIACSEALLQRFIIFSQRRGAQTVRDALCPLSQVTLQWI 240  house mouse
P78363    241 EDTLYANVDFFKLFRVLPTLLDSRSQGINLRSWGGILSDMSPRIQEFIHRPSMQDLLWVTRPLMQNGGPETFTKLMGILS 320  human
AAC48716  241 EDTLYANVDFFKLFHVFPRLLDSRSQGMNLRSWGRILSDMSPRIQEFIHRPSVQDLLWVTRPLVQTGGPETFTQLMGILS 320  cattle
AAC23916  241 EDTLYADVDFFKLFHVLPTLLDSSSQGINLRFWGGILSDLSPRMQKFIHRPSVQDLLWVSRPLLQNGGPETFTQLMSILS 320  house mouse
P78363    321 DLLCGYPEGGGSRVLSFNWYEDNNYKAFLGIDSTRKDPIYSYDRRTTSFCNALIQSLESNPLTKIAWRAAKPLLMGKILY 400  human
AAC48716  321 DLLCGYPEGGGSRVFSFNWYEDNNYKAFLGIDSTRKDPIYSYDERTTTFCNALIQSLESNPLTKIAWRAAKPLLMGKILF 400  cattle
AAC23916  321 DLLCGYPEGGGSRVFSFNWYEDNNYKAFLGIDSTRKDPAYSYDKRTTSFCNSLIQSLESNPLTKIAWRAAKPLLMGKILF 400  house mouse
P78363    401 TPDSPAARRILKNANSTFEELEHVRKLVKAWEEVGPQIWYFFDNSTQMNMIRDTLGNPTVKDFLNRQLGEEGITAEAILN 480  human
AAC48716  401 TPDSPATRRILKNANSTFEELERVRKLVKVWEEVGPQIWYFFDKSTQMSMIRDTLENPTVKAFWNRQLGEEGITAEAVLN 480  cattle
AAC23916  401 TPDSPAARRIMKNANSTFEELDRVRKLVKAWEEVGPQIWYFFEKSTQMTVIRDTLQHPTVKDFINRQLGEEGITTEAVLN 480  house mouse
P78363    481 FLYKGPRESQADDMANFDWRDIFNITDRTLRLVNQYLECLVLDKFESYNDETQLTQRALSLLEENMFWAGVVFPDMYPWT 560  human
AAC48716  481 FLYNGPREGQADDVDNFNWRDIFNITDRALRLANQYLECLILDKFESYDDEFQLTQRALSLLEENRFWAGVVFPDMHPWT 560  cattle
AAC23916  481 FFSNGPQEKQADDMTSFDWRDIFNITDRFLRLANQYLECLVLDKFESYDDEVQLTQRALSLLEENRFWAGVVFPGMYPWA 560  house mouse
P78363    561 SSLPPHVKYKIRMDIDVVEKTNKIKDRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGITRSQVQAEAPVGIYLQQMPYP 640  human
AAC48716  561 SSLPPHVKYKIRMDIDVVEKTNKIKDRYWDSGPRADPVEDFRYIWGGFAYLQDMVEHGITRSQAQEEVPVGIYLQQMPYP 640  cattle
AAC23916  561 SSLPPHVKYKIRMDIDVVEKTNKIKDRYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGIVKSQMQAEPPIGVYLQQMPYP 640  house mouse
P78363    641 CFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMSMSIFLLTIFIM 720  human
AAC48716  641 CFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKSIVLEKELRLKETLKNQGVSNRVIWCTWFLDSFSIMSMSICLLTIFIM 720  cattle
AAC23916  641 CFVDDSFMIILNRCFPIFMVLAWIYSVSMTVKGIVLEKELRLKETLKNQGVSNAVIWCTWFLDSFSIMALSIFLLTLFIM 720  house mouse
P78363    721 HGRILHYSDPFILFLFLLAFSTATIMLCFLLSTFFSKASLAAACSGVIYFTLYLPHILCFAWQDRMTAELKKAVSLLSPV 800  human
AAC48716  721 HGRILHYSNPFILFLFLLAFSIATIMQCFLLSTFFSRASLAAACSGVIYFTLYLPHILCFAWQDRITADMKMAVSLLSPV 800  cattle
AAC23916  721 HGRILHYSDPFILFLFLLAFATATIMQSFLLSTLFSKASLAAACSGVIYFTLYLPHVLCFAWQDRMTADLKTTVSLLSSV 800  house mouse
P78363    801 AFGFGTEYLVRFEEQGLGLQWSNIGNSPTEGDEFSFLLSMQMMLLDAAVYGLLAWYLDQVFPGDYGTPLPWYFLLQESYW 880  human
AAC48716  801 AFGFGTEYLAXFEEQGVGLQWSNIGNSPMEGDEFSFLMSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLPWYFLLQESYW 880  cattle
AAC23916  801 AFGFGTEYLVRFEEQGLGLQWSNIGKSPLEGDEFSFLLSMKMMLLDAALYGLLAWYLDQVFPGDYGTPLPWYFLLQESYW 880  house mouse
P78363    881 LGGEGCSTREERALEKTEPLTEETEDPEHPEGIHDSFFEREHPGWVPGVCVKNLVKIFEPCGRPAVDRLNITFYENQITA 960  human
AAC48716  881 LGGEGCSTREERALEKTEPITEEMEDPEYPEGINDCFFERELPGLVPGVCVKNLVKIFEPYGRPAVDRLNITFYESQITA 960  cattle
AAC23916  881 LGGEGCSTREERALEKTEPLTEEMEDPEHPEGMNDSFFERELPGLVPGVCVKNLVKVFEPSGRPAVDRLNITFYENQITA 960  house mouse
P78363    961 FLGHNGAGKTTTLSILTGLLPPTSGTVLVGGRDIETSLDAVRQSLGMCPQHNILFHHLTVAEHMLFYAQLKGKSQEEAQL 1040 human
AAC48716  961 FLGHNGAGKTTTLSIMTGLLPPTSGTVLVGGKDIETNLDAIRQSLGMCPQHNILFHHLTVAEHILFYAQLKGRSWDEAQL 1040 cattle
AAC23916  961 FLGHNGAGKTTTLSILTGLLPPTSGTVLIGGKDIETNLDVVRQSLGMCPQHNILFHHLTVAEHILFYAQLKGRSWEEAQL 1040 house mouse
P78363   1041 EMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLLKYRSGRTIIMSTHHM 1120 human
AAC48716 1041 EMEAMLEDTGLHHKRNEEARDLSGGVQRKLSVAIAFVGDAKVVVLDEPTSGVDPYSRRSIWDLLLKYRSGRTIIMSTHHM 1120 cattle
AAC23916 1041 EMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDSKVVVLDEPTSGVDPYSRRSIWDLLLKYRSGRTIIMSTHHM 1120 house mouse
P78363   1121 DEADLLGDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQV 1200 human
AAC48716 1121 DEADILGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRRMKTIQSQGRGREATCSCASKGFSVRCPACAEAITPEQV 1200 cattle
AAC23916 1121 DEADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQV 1200 house mouse
P78363   1201 LDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDS 1280 human
AAC48716 1201 LDGDVNELTDMVHHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDL 1280 cattle
AAC23916 1201 LDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDA 1280 house mouse
P78363   1281 DSGPLFAGGAQQKRENVNPRHPCLGPREKAGQTPQDSnVCSPGAPAAHPEGQPPPEPECpGPQLNTGTQLVLQHVQALLV 1360 human
AAC48716 1281 DSGHLFAGGTQQKRENINLRHPCSGPSEKAGQTPQGS-SSHPGEPAAHPEGQPPPEREG-HSRLNSGARLIVQHVQALLV 1358 cattle
AAC23916 1281 GAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPhTCSPGQ-VDPPKGQPSPEPEDpGVPFNTGARLILQHVQALLV 1359 house mouse
P78363   1361 KRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWIYGQQYTFFSMDEPGSEQFTVLADVLLNKPGF 1440 human
AAC48716 1359 KRFQHTIRSHKDFLAQIVLPATFVFLALMLSLIIPPFGEYPALTLHPWMYGQQYTFFSMDQPDSEWLSALADVLVNKPGF 1438 cattle
AAC23916 1360 KRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWMYGHQYTFFSMDEPNNEHLEVLADVLLNRPGF 1439 house mouse
P78363   1441 GNRCLKEGWLPEYPCGNSTPWKTPSVSPNITQLFQKQKWTQVNPSPSCRCSTREKLTMLPECPEGAGGLPPPQRTQRSTE 1520 human
AAC48716 1439 GNRCLKEEWLPEFPCGNSSPWKTPSVSPDVTHLLQQQKWTADQPSPSCRCSTREKLTMLPECPEGAGGLPPPQRIQRSTE 1518 cattle
AAC23916 1440 GNRCLKEEWLPEYPCINATSWKTPSVSPNITHLFQKQKWTAAHPSPSCKCSTREKLTMLPECPEGAGGLPPPQRTQRSTE 1519 house mouse
P78363   1521 ILQDLTDRNISDFLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPVVPITGEALVGFLSDLGRIMNVSGGPITREASK 1600 human
AAC48716 1519 ILQDLTDRNVSDFLVKTYPALIRSSLKSKFWVNEQRYGGISVGGKLPAPPFTGEALVGFLSDLGQLMNVSGGPMTREAAK 1598 cattle
AAC23916 1520 VLQDLTNRNISDYLVKTYPALIRSSLKSKFWVNEQRYGGISIGGKLPAIPISGEALVGFLSGLGQMMNVSGGPVTREASK 1599 house mouse
P78363   1601 EIPDFLKHLETEDNIKVWFNNKGWHALVSFLNVAHNAILRASLPKDRSPEEYGITVISQPLNLTKEQLSEITVLTTSVDA 1680 human
AAC48716 1599 EMPAFLKQLETEDNIKVWFNNKGWHALVSFLNVAHNAILRASLHKDKNPEEYGITVISQPLNLTKEQLSEITVLTTSVDA 1678 cattle
AAC23916 1600 EMLDFLKHLETTDNIKVWFNNKGWHALVSFLNVAHNAILRASLPRDRDPEEYGITVISQPLNLTKEQLSDITVLTTSVDA 1679 house mouse
P78363   1681 VVAICVIFSMSFVPASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENL 1760 human
AAC48716 1679 VVAICVIFAMSFVPASFVLYLIQERVNKAKHLQFVSGVSPTTYWLTNFLWDIMNYTVSAALVVGIFIGFQKKAYTSSENL 1758 cattle
AAC23916 1680 VVAICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNL 1759 house mouse
P78363   1761 PALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFENNRTLLRFNAVLRKLLIVFPHFC 1840 human
AAC48716 1759 PALVALLMLYGWAVIPMMYPASFLFDIPSTAYVALSCANLFIGINSSAITFVLELFENNRTLLRINAMLRKLLIIFPHFC 1838 cattle
AAC23916 1760 PALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFENNRTLLRFNAMLRKLLIVFPHFC 1839 house mouse
P78363   1841 LGRGLIDLALSQAVTDVYARFGEEHSANPFHWDLIGKNLFAMVVEGVVYFLLTLLVQRHFFLSQWIAEPTKEPIVDEDDD 1920 human
AAC48716 1839 LGRGLIDLALSQAVTDVYAQFGEAHSSNPFQWDLIGKNLAAMAVEGVVYFLLTLLIQYQFFFSRWTTEPAKEPITDEDDD 1918 cattle
AAC23916 1840 LGRGLIDLALSQAVTDVYAQFGEEYSANPFQWDLIGKNLVAMAIEGVVYFLLTLLIQHHFFLTRWIAEPAREPVFDEDDD 1919 house mouse
P78363   1921 VAEERQRIITGGNKTDILRLHELTKIYPGTSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAG 2000 human
AAC48716 1919 VAEERQRIISGGNKTDILRLNELTKVYSGTSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTAVTSGDATVAG 1998 cattle
AAC23916 1920 VAEERQRVMSGGNKTDILKLNELTKVYSGSSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAG 1999 house mouse
P78363   2001 KSILTNISEVHQNMGYCPQFDAIDELLTGREHLYLYARLRGVPAEEIEKVANWSIKSLGLTVYADCLAGTYSGGNKRKLS 2080 human
AAC48716 1999 KSILTNISDVHQSMGYCPQFDAIDDLLTGREHLYLYARLRGVPAEEIERVTNWSIQSLGLSLYADRLAGTYSGGNKRKLS 2078 cattle
AAC23916 2000 KSILTSISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKLS 2079 house mouse
P78363   2081 TAIALIGCPPLVLLDEPTTGMDPQARRMLWNVIVSIIREGRAVVLTSHSMEECEALCTRLAIMVKGAFRCMGTIQHLKSK 2160 human
AAC48716 2079 TAIALIGCPPLVLLDEPTTGMDPQARRMLWNTIMGIIREERAVVLTSHSMEECEALCTRLAIMVKGAFQCLGTIQHLKSK 2158 cattle
AAC23916 2080 TAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGRAVVLTSHSMEECEALCTRLAIMVKGTFQCLGTIQHLKYK 2159 house mouse
P78363   2161 FGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQRERHYNMLQFQVSSSSLARIFQLLLSHKDSLLIEEYSVTQTT 2240 human
AAC48716 2159 FGDGYIVTMKIRSPKDDLLPDLGPVEQFFQGNFPGSVQRERHYNTLQFQVSSSSLARIFRLLVSHKDSLLIEEYSVTQTT 2238 cattle
AAC23916 2160 FGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQRERHHSMLQFQVPSSSLARIFQLLISHKDSLLIEEYSVTQTT 2239 house mouse
P78363   2241 LDQVFVNFAKQQTESHDLPLHPRAAGASRQAQ 2272 human
AAC48716 2239 LDQVFVNFAKQQNETYDLPLHPRTAGASRQAK 2270 cattle
AAC23916 2240 LDQVFVNFAKQQTETYDLPLHPRAAGASWQAK 2271 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap