Conserved Protein Domain Family
thiP

?
TIGR01253: thiP 
thiamine ABC transporter, permease protein
The model describes thiamine ABC transporter, permease protein in bacteria. The protein belongs to the larger ABC transport system. It consists of atleast three components: the inner mebrane permease; thiamine binding protein; an ATP-binding subunit. It has been experimentally demonstrated that the mutants in the various steps in the de novo synthesis of the thiamine and the biologically active form, namely thiamine pyrophosphate can be exogenously supplemented with thiamine, thiamine monophosphate (TMP) or thiamine pyrophosphate (TPP). [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130320
View PSSM: TIGR01253
Aligned: 2 rows
Threshold Bit Score: 764.848
Threshold Setting Gi: 1175489
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P31549   8 LIPGWLIPGVSATTLVVAVALAAFLALWWNAPQDDWVAVWQDSYLWHVVRFSFWQAFLSALLSVIPAIFLARALYRRRFP 87  Escherichia coli K-12
P44985  10 LRPRHYAGGVVVISFIILFYGGALSSIFALGGELQWRAWFTDDYLQHLILFSFGQALLSTVLSIFFGLLLARALFYKPFL 89  Haemophilus influenza...
P31549  88 GRLALLRLCAMTLILPVLVAVFGILSVYGRQGWLATLCQSLGLEWTFSPYGLQGILLAHVFFNLPMASRLLLQALENIPG 167 Escherichia coli K-12
P44985  90 GKKWLLKLMSLTFVLPALVVIFGLIGIYGSSGWLAWLANLFGMSWQGHIYGLSGILIAHLFFNIPLAAQLFLQSLQSIPY 169 Haemophilus influenza...
P31549 168 EQRQLAAQLGMRSWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQATTIELAIYQALSYDYDPARAAMLA 247 Escherichia coli K-12
P44985 170 QQRQLAAQLNLQGWQFVKLVEWPVFRQQCLPTFSLIFMLCFTSFTVVLTLGGGPQYTTLETAIYQAILFEFDLPKAALFA 249 Haemophilus influenza...
P31549 248 LLQMVCCLGLVLLSQRLSKAIAPGTTLLQGWRDpDDRLHSRICDTVLIVLALLLLLPPLLAVIVDGVN-RQLPEVLAQPV 326 Escherichia coli K-12
P44985 250 MLQFVFCLILFSLTSRFSLSNQNGLSNSNIWFE-KPKSAVKIFHILVLLVFVFFLFSPVLNILISALSsSNLLTVWHNSQ 328 Haemophilus influenza...
P31549 327 LWQALWTSLRIALAAGVLCVVLTMMLLWSSRELRARQKMLAGQVLEMSGMLILAMPGIVLATGFFLLLNNTIGLPQSADG 406 Escherichia coli K-12
P44985 329 LWRALGYSLSIAPLSALLALTMAIALLLLSRRLEWLHYQKISQFIINAGMVILAIPILVLAMGLFLLLQDRDFSNIDLFI 408 Haemophilus influenza...
P31549 407 IVIFTNALMAIPYALKVLENPMRDITARYSMLCQSLGIEGWSRLKVVELRALKRPLAQALAFACVLSIGDFGVVALFGND 486 Escherichia coli K-12
P44985 409 IVVFCNALSAMPFVLRILSAPFHNNMRYYENLCNSLGIVGWQRFYLIEWKTLRAPLRYAFALGLALSLGDFTAIALFGNQ 488 Haemophilus influenza...
P31549 487 DFRTLPFYLYQQIGSYRSQDGAVTALILLLLCFLLFTVI 525 Escherichia coli K-12
P44985 489 EFTSLPHLLYQQLGNYRNQDAAVTAGILLLLCGILFAFI 527 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap