Conserved Protein Domain Family
drrC

?
TIGR01248: drrC 
daunorubicin resistance protein C
The model describes daunorubicin resistance protein C in bacteria. This protein confers the function of daunorubicin resistance. The protein seems to share strong sequence similarity to UvrA proteins, which are involved in excision repair of DNA. Disruption of drrC gene showed increased sensitivity upon exposure to duanorubicin. However it failed to complement uvrA mutants to exposure to UV irradiation. The mechanism on how it confers duanomycin resistance is unclear, but has been suggested to be different from DrrA and DrrB which are antiporters. [Unclassified, Role category not yet assigned]
Statistics
?
PSSM-Id: 130315
View PSSM: TIGR01248
Aligned: 2 rows
Threshold Bit Score: 211.37
Threshold Setting Gi: 5524334
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD44227  76 ALFGSLGNSVGITIDRESRVLSRMWVLPIHRASAVTGWVIAEVVRALIGTILITAIALAMGLRFTNGWAAALLFLLIPSI 155 Mycobacterium avium
AAA17365  91 AITGSTFVAIDLVRERSIGLLSRLWVLPIHRASGLLARILANTIRTFVTTLVMLVTGVILGFRFRQGVIASLMWVSVPVI 170 Mycobacterium leprae
AAD44227 156 TVTGFTALVMAMAVRKKGRTAMTWLLSATFALAFVNPGATPIKLFPDWARPLIRMQPISPPIEAMRSLAHGG 227 Mycobacterium avium
AAA17365 171 FGIAIAVMVTTVALYTEQTFVVEAVELVQAIAVFLSTGLVPLNQYPGWIQPLVAHQPVSYALRRCADYRWGG 242 Mycobacterium leprae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap