Conserved Protein Domain Family
drrB

?
TIGR01247: drrB 
daunorubicin resistance ABC transporter membrane protein
This model describes daunorubicin resistance ABC transporter, membrane associated protein in bacteria and archaea. The protein associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130314
View PSSM: TIGR01247
Aligned: 4 rows
Threshold Bit Score: 293.602
Threshold Setting Gi: 499179176
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010867783  13 RELKRFIRSRARVLGSLLNPLIWLIFFGKGWAGAFNFPgakM---IFGGVDYMTYLVPGIVAMTVFNMGFMQGITLIWDR 89  Pyrococcus abyssi
WP_010885003  13 RELKRFIRSPSRIIGSILNPLLWLIFFGKGWSGVFNFP---MatrIFGGVDYMTYLVPGVVVMTVFDMSFLQGLTIIWDK 89  Pyrococcus hori...
WP_010879376  10 RQIKRFLRARSRVAGMIINPLVWLTFFGIGWSRAFRDP---S---IFGGVDYLTYLSPGIFAMTVFNQSFVSGISVIWDR 83  Archaeoglobus f...
WP_010876716  16 REMKRFFRYRSRIVTSIVTPLLWLIIFGTGLGAAVRFG---G---VPGG--YKAFIYPGIIGQTVLFTSIFSGVSVIIDR 87  Methanothermoba...
WP_010867783  90 QFGFLKELLVAPASRVEAIIGRSIGGALMALIQGTIILALSFTLAD-LKLSGVVPTLLLAFLVGIAVSGMGMAIAMRMTS 168 Pyrococcus abyssi
WP_010885003  90 QFGFMKEILVAPASRVESILGRITGGAIVAMIQGFIMVALSFIVAN-LKVSGVIPTLILAFFVGVAIAGLGVAVALKMSS 168 Pyrococcus hori...
WP_010879376  84 EFGFLKEVLVAPASRKETIAGRIFGDSAVATLQGAIILALTFFIAR-INIFGVIPALGVGFVLAVAFSSFGVSIAARMRS 162 Archaeoglobus f...
WP_010876716  88 QYGFLKEILVAPISRESMVVGKALGISTASMIQAAILLALSFIVGItMSPQCFIVSMVIALIISMGLGGLGLVIAAFTDS 167 Methanothermoba...
WP_010867783 169 MEGFQIIVTMLMLPMTFLSGAFYPISTMPKWMQYLAKINPLTYAVDGARYYLAGINPTFSLAIDWGVLSLLAVIFVGIAA 248 Pyrococcus abyssi
WP_010885003 169 MEGFQIIVMMLMLPMMFLSGAFYPVRTMPNWMQWLAKINPLTYAVDGARYYLAGVTPTFGIMQDWIVLILLALVFAGFAG 248 Pyrococcus hori...
WP_010879376 163 MEGFQMIMALVMLPLIFLSGAIYPIAFMPAWMKVLALLNPLTYAVESSRVLLTGVSGIFPLDQSLLILLSLTALMLYVAM 242 Archaeoglobus f...
WP_010876716 168 MEGFNLIMSFIVLPIFLLSGALFPITGLPAWLQGAVYINPLTYAVDALRFTILRRS-VLPLEVNLLVITIFAVIAVLIAA 246 Methanothermoba...
WP_010867783 249 VEF 251 Pyrococcus abyssi
WP_010885003 249 LEF 251 Pyrococcus horikoshii
WP_010879376 243 VSF 245 Archaeoglobus fulgidus
WP_010876716 247 FLF 249 Methanothermobacter thermautotrophicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap